Protein Family IF12160
Metagenome
Isolate
236
Members
104
Samples
182
Scaffolds
347.43
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820768849|2820769987|
- Length
- 407 aa
- Sequence
- MATKRDYYEILEVSKTATADEIKKAYRQAALKYHPDKNPGDKAAEEKFKEAAEAYDVLSDADKRARYDQFGHAGMSGAAGGPGGGFSGGGFTMEDIFRNFGDIFGGHFGGGMGGGRGGFSTFEFDMGGMGGGFAGGGGRGGRRVNRGSDLRVKVKLSLKEIANGTTKKLKINKMVTCDKCGGTGAKTPDSYTTCAACNGSGYVTQVVNTIFGRTQSTVQCPTCHGDGRTIKDKCDKCHGEGIVRGEEVVEIKIPAGVGAGMQLSVSGKGNAARHGGVNGDLLVIIEEERHPELERDGSDLLYNLALTIPEAVLGGMVEVPTIEGKAKVKVQPGTVAGQVLRLKGKGIPDLNGYGRGDILAVVDIAVPAKLSADEKRLVEELGRTPSFAKAEKKVRQNIFDRMRSFFR
Sample Types
Isolate
22.9%
Metagenome
77.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.4%
Blattidae
20.6%
Termitidae
19.6%
Kalotermitidae
13.7%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Passalidae
2.9%
Hydrophilidae
2.0%
Panorpidae
1.0%
Hodotermitidae
1.0%
Culicidae
1.0%
Cerambycidae
1.0%
Drosophilidae
1.0%
Taxonomy
Archaea
1
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 2 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 3 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 4 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 5 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 6 | 2843673047 | Spiroplasma alleghenense PLHS-1 | Isolate | Panorpidae |
| 7 | 2561511100 | Mesoplasma photuris ATCC 49581 | Isolate | Unclassified |
| 8 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 22 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 23 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 24 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 25 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 26 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 27 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 28 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 31 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 32 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 2558860238 | Spiroplasma sabaudiense Ar-1343 | Isolate | Culicidae |
| 38 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 39 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 47 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 48 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 53 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 54 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 55 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 56 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 57 | 2802429270 | Mesoplasma chauliocola CHPA-2 | Isolate | Unclassified |
| 58 | 2806310970 | Mesoplasma florum MQ3 | Isolate | Unclassified |
| 59 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 60 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 61 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 62 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 67 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 68 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 69 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 70 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 71 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 72 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 73 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 74 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 75 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 76 | 2545555831 | Mesoplasma chauliocola ATCC 49578 | Isolate | Unclassified |
| 77 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 78 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 79 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 80 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 81 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 82 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 83 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 84 | 2806310895 | Mesoplasma florum CnuA-2 | Isolate | Unclassified |
| 85 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 86 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 87 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 88 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 92 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 93 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 94 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 95 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 96 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 97 | 2561511101 | Mesoplasma grammopterae ATCC 49580 | Isolate | Cerambycidae |
| 98 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 99 | 2806310987 | Mesoplasma florum BARC 787 | Isolate | Unclassified |
| 100 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 101 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 102 | 2773857695 | Unclassified Methanosarcinaceae Th196P4bin37 | Isolate | Unclassified |
| 103 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 104 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_056566 | 3300042659 | Bacteria | 66737 |
| 2 | Ga0466733_145952 | 3300042659 | Bacteria | 16748 |
| 3 | Ga0466703_082463 | 3300042636 | Bacteria | 12255 |
| 4 | Ga0466703_294332 | 3300042636 | Bacteria | 3669 |
| 5 | Ga0466709_306520 | 3300042648 | Bacteria | 32391 |
| 6 | Ga0123355_10001922 | 3300009826 | Unclassified | 29203 |
| 7 | Ga0123356_10008214 | 3300010049 | Bacteria | 10388 |
| 8 | Ga0123353_10150198 | 3300010167 | Bacteria | 3720 |
| 9 | Ga0123353_10457604 | 3300010167 | Bacteria | 1876 |
| 10 | Ga0466706_020182 | 3300042599 | Bacteria | 36010 |
| 11 | Ga0466713_089870 | 3300042602 | Bacteria | 67596 |
| 12 | Ga0466714_027987 | 3300042603 | Bacteria | 18048 |
| 13 | Ga0466716_156121 | 3300042605 | Bacteria | 5646 |
| 14 | Ga0466719_058825 | 3300042606 | Bacteria | 4933 |
| 15 | Ga0466722_000483 | 3300042609 | Bacteria | 1365 |
| 16 | Ga0466722_055335 | 3300042609 | Bacteria | 5264 |
| 17 | Ga0466711_148883 | 3300042615 | Bacteria | 17879 |
| 18 | Ga0466715_040088 | 3300042616 | Bacteria | 6104 |
| 19 | Ga0466728_156927 | 3300042620 | Bacteria | 6361 |
| 20 | 2226985928 | 2225789003 | Bacteria | 8200 |
| 21 | JGI24702J35022_10054020 | 3300002462 | Unclassified | 2143 |
| 22 | Ga0068302_10453946 | 3300005071 | Bacteria | 1357 |
| 23 | Ga0068305_10170118 | 3300005083 | Bacteria | 3763 |
| 24 | Ga0072941_1041677 | 3300005201 | Bacteria | 14041 |
| 25 | Ga0466692_108140 | 3300042591 | Bacteria | 2436 |
| 26 | Ga0466696_478533 | 3300042596 | Bacteria | 8283 |
| 27 | Ga0466705_013543 | 3300042612 | Bacteria | 4621 |
| 28 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 29 | Ga0123357_10014725 | 3300009784 | Bacteria | 10221 |
| 30 | Ga0123357_10019811 | 3300009784 | Bacteria | 8979 |
| 31 | Ga0123356_10000553 | 3300010049 | Bacteria | 41455 |
| 32 | Ga0123353_10065740 | 3300010167 | Bacteria | 5822 |
| 33 | Ga0123353_10384275 | 3300010167 | Bacteria | 2098 |
| 34 | Ga0123354_10130814 | 3300010882 | Bacteria | 3171 |
| 35 | Ga0466706_098738 | 3300042599 | Unclassified | 1773 |
| 36 | Ga0466700_236184 | 3300042600 | Bacteria | 3835 |
| 37 | Ga0466707_033660 | 3300042601 | Bacteria | 25263 |
| 38 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 39 | Ga0466716_479841 | 3300042605 | Bacteria | 3977 |
| 40 | Ga0466722_205034 | 3300042609 | Bacteria | 7070 |
| 41 | Ga0466722_238358 | 3300042609 | Bacteria | 4978 |
| 42 | Ga0466715_051135 | 3300042616 | Bacteria | 47345 |
| 43 | Ga0466715_177129 | 3300042616 | Bacteria | 4142 |
| 44 | Ga0466728_025982 | 3300042620 | Bacteria | 7629 |
| 45 | Ga0072941_1166719 | 3300005201 | Bacteria | 1872 |
| 46 | Ga0466692_066865 | 3300042591 | Bacteria | 168349 |
| 47 | Ga0466705_032663 | 3300042612 | Bacteria | 37888 |
| 48 | Ga0466733_078804 | 3300042659 | Bacteria | 5915 |
| 49 | Ga0466733_138271 | 3300042659 | Bacteria | 8774 |
| 50 | Ga0466703_292679 | 3300042636 | Bacteria | 5245 |
| 51 | Ga0123355_10000171 | 3300009826 | Bacteria | 79083 |
| 52 | Ga0123356_10008147 | 3300010049 | Bacteria | 10434 |
| 53 | Ga0123353_10000053 | 3300010167 | Bacteria | 130089 |
| 54 | Ga0466706_275748 | 3300042599 | Bacteria | 2526 |
| 55 | Ga0466707_079600 | 3300042601 | Bacteria | 16086 |
| 56 | Ga0466707_316195 | 3300042601 | Bacteria | 16187 |
| 57 | Ga0466713_044001 | 3300042602 | Bacteria | 42258 |
| 58 | Ga0466713_053881 | 3300042602 | Bacteria | 5860 |
| 59 | Ga0466714_092925 | 3300042603 | Bacteria | 5260 |
| 60 | Ga0466714_112288 | 3300042603 | Bacteria | 2952 |
| 61 | Ga0466711_163604 | 3300042615 | Bacteria | 13391 |
| 62 | Ga0466711_512190 | 3300042615 | Unclassified | 21377 |
| 63 | Ga0466715_492108 | 3300042616 | Bacteria | 3670 |
| 64 | Ga0466715_508757 | 3300042616 | Bacteria | 23089 |
| 65 | Ga0466726_258515 | 3300042619 | Bacteria | 4146 |
| 66 | 2227275220 | 2225789004 | Bacteria | 30751 |
| 67 | JGI24705J35276_12192432 | 3300002504 | Bacteria | 1487 |
| 68 | Ga0068305_10004729 | 3300005083 | Bacteria | 14351 |
| 69 | Ga0104048_1169770 | 3300007143 | Bacteria | 1887 |
| 70 | Ga0466692_052142 | 3300042591 | Bacteria | 15919 |
| 71 | Ga0466696_466055 | 3300042596 | Bacteria | 7375 |
| 72 | Ga0466733_084798 | 3300042659 | Bacteria | 16934 |
| 73 | Ga0466729_212262 | 3300042621 | Bacteria | 7254 |
| 74 | Ga0466735_144837 | 3300042624 | Bacteria | 2075 |
| 75 | Ga0466735_230218 | 3300042624 | Bacteria | 3943 |
| 76 | Ga0466703_157161 | 3300042636 | Bacteria | 4756 |
| 77 | Ga0466703_179048 | 3300042636 | Bacteria | 1528 |
| 78 | Ga0466704_043571 | 3300042643 | Bacteria | 8375 |
| 79 | Ga0466725_251772 | 3300042654 | Bacteria | 19267 |
| 80 | Ga0123353_10445211 | 3300010167 | Bacteria | 1909 |
| 81 | Ga0466706_225176 | 3300042599 | Bacteria | 38857 |
| 82 | Ga0466700_376010 | 3300042600 | Bacteria | 38603 |
| 83 | Ga0466713_062226 | 3300042602 | Bacteria | 23233 |
| 84 | Ga0466713_089753 | 3300042602 | Bacteria | 35618 |
| 85 | Ga0466716_118575 | 3300042605 | Bacteria | 8693 |
| 86 | Ga0466716_321671 | 3300042605 | Bacteria | 3266 |
| 87 | Ga0466719_566801 | 3300042606 | Bacteria | 5443 |
| 88 | Ga0466722_074555 | 3300042609 | Bacteria | 4611 |
| 89 | Ga0466698_253056 | 3300042610 | Bacteria | 1911 |
| 90 | IMNBL1DRAFT_c0001045 | 3300000062 | Bacteria | 21425 |
| 91 | JGI24695J34938_10001751 | 3300002450 | Bacteria | 17958 |
| 92 | JGI24699J35502_11133994 | 3300002509 | Bacteria | 23331 |
| 93 | JGI24696J40584_12960450 | 3300002834 | Bacteria | 7282 |
| 94 | Ga0068305_10001331 | 3300005083 | Bacteria | 81205 |
| 95 | Ga0466691_086050 | 3300042593 | Bacteria | 33199 |
| 96 | Ga0466705_026614 | 3300042612 | Bacteria | 11254 |
| 97 | Ga0466702_115878 | 3300042635 | Bacteria | 4317 |
| 98 | Ga0466704_042270 | 3300042643 | Unclassified | 3952 |
| 99 | Ga0466709_420512 | 3300042648 | Bacteria | 4825 |
| 100 | Ga0466727_042687 | 3300042655 | Bacteria | 90775 |
| 101 | Ga0466727_224853 | 3300042655 | Bacteria | 23233 |
| 102 | Ga0123357_10083476 | 3300009784 | Bacteria | 4193 |
| 103 | Ga0123355_10000270 | 3300009826 | Bacteria | 66244 |
| 104 | Ga0123353_10583083 | 3300010167 | Bacteria | 1604 |
| 105 | Ga0123354_10032871 | 3300010882 | Bacteria | 8125 |
| 106 | Ga0466707_019758 | 3300042601 | Bacteria | 35482 |
| 107 | Ga0466713_015686 | 3300042602 | Bacteria | 17898 |
| 108 | Ga0466713_150937 | 3300042602 | Bacteria | 9507 |
| 109 | Ga0466714_023328 | 3300042603 | Bacteria | 19373 |
| 110 | Ga0466716_033834 | 3300042605 | Bacteria | 1827 |
| 111 | Ga0466722_045245 | 3300042609 | Bacteria | 45507 |
| 112 | Ga0466711_060142 | 3300042615 | Bacteria | 9556 |
| 113 | Ga0466723_018128 | 3300042618 | Bacteria | 12018 |
| 114 | Ga0466723_126779 | 3300042618 | Bacteria | 5695 |
| 115 | Ga0466726_120635 | 3300042619 | Bacteria | 13835 |
| 116 | 2227347458 | 2225789004 | Bacteria | 6197 |
| 117 | IMNBL1DRAFT_c0009480 | 3300000062 | Bacteria | 4802 |
| 118 | JGI24695J34938_10001696 | 3300002450 | Bacteria | 18208 |
| 119 | Ga0068302_10009605 | 3300005071 | Bacteria | 4072 |
| 120 | Ga0466692_094457 | 3300042591 | Bacteria | 31045 |
| 121 | Ga0466692_116427 | 3300042591 | Bacteria | 133716 |
| 122 | Ga0466696_387176 | 3300042596 | Bacteria | 50828 |
| 123 | Ga0466705_189810 | 3300042612 | Bacteria | 1965 |
| 124 | Ga0466709_041946 | 3300042648 | Bacteria | 1599 |
| 125 | Ga0466708_180067 | 3300042652 | Bacteria | 29640 |
| 126 | Ga0123356_10017897 | 3300010049 | Unclassified | 6732 |
| 127 | Ga0123353_10000503 | 3300010167 | Bacteria | 48547 |
| 128 | Ga0466706_013829 | 3300042599 | Bacteria | 33879 |
| 129 | Ga0466706_154397 | 3300042599 | Bacteria | 3613 |
| 130 | Ga0466706_200536 | 3300042599 | Bacteria | 17217 |
| 131 | Ga0466714_155625 | 3300042603 | Bacteria | 2103 |
| 132 | Ga0466710_415330 | 3300042613 | Bacteria | 3083 |
| 133 | Ga0466711_058883 | 3300042615 | Bacteria | 2317 |
| 134 | Ga0466728_029017 | 3300042620 | Bacteria | 35653 |
| 135 | JGI24702J35022_10000511 | 3300002462 | Bacteria | 23507 |
| 136 | JGI24702J35022_10034105 | 3300002462 | Bacteria | 2722 |
| 137 | Ga0466690_047506 | 3300042590 | Bacteria | 2212 |
| 138 | Ga0466691_076870 | 3300042593 | Bacteria | 6717 |
| 139 | Ga0466691_132978 | 3300042593 | Bacteria | 2228 |
| 140 | Ga0466696_215941 | 3300042596 | Bacteria | 8391 |
| 141 | Ga0466703_014538 | 3300042636 | Bacteria | 89399 |
| 142 | Ga0466704_352277 | 3300042643 | Bacteria | 13970 |
| 143 | Ga0466709_260200 | 3300042648 | Bacteria | 17443 |
| 144 | Ga0466708_072667 | 3300042652 | Bacteria | 28691 |
| 145 | Ga0466725_096755 | 3300042654 | Bacteria | 21543 |
| 146 | Ga0123357_10149267 | 3300009784 | Bacteria | 2843 |
| 147 | Ga0123356_10031534 | 3300010049 | Bacteria | 4959 |
| 148 | Ga0123354_10001224 | 3300010882 | Bacteria | 30412 |
| 149 | Ga0123354_10313968 | 3300010882 | Bacteria | 1458 |
| 150 | Ga0466701_034936 | 3300042598 | Bacteria | 51193 |
| 151 | Ga0466707_235618 | 3300042601 | Bacteria | 12371 |
| 152 | Ga0466713_031330 | 3300042602 | Bacteria | 95179 |
| 153 | Ga0466714_135420 | 3300042603 | Bacteria | 3261 |
| 154 | Ga0466716_114977 | 3300042605 | Bacteria | 23750 |
| 155 | Ga0466698_067901 | 3300042610 | Bacteria | 1694 |
| 156 | Ga0466698_406596 | 3300042610 | Bacteria | 4626 |
| 157 | Ga0466723_236631 | 3300042618 | Bacteria | 23560 |
| 158 | IMNBL1DRAFT_c0001881 | 3300000062 | Bacteria | 15279 |
| 159 | Ga0068302_10077713 | 3300005071 | Unclassified | 4203 |
| 160 | Ga0072941_1370258 | 3300005201 | Bacteria | 2049 |
| 161 | Ga0466657_329353 | 3300042582 | Bacteria | 8232 |
| 162 | Ga0466690_379955 | 3300042590 | Bacteria | 6183 |
| 163 | Ga0466690_401381 | 3300042590 | Bacteria | 6397 |
| 164 | Ga0466692_032866 | 3300042591 | Bacteria | 37963 |
| 165 | Ga0466705_206919 | 3300042612 | Bacteria | 17345 |
| 166 | Ga0466704_085703 | 3300042643 | Bacteria | 3180 |
| 167 | Ga0466709_340185 | 3300042648 | Bacteria | 22865 |
| 168 | Ga0466708_254920 | 3300042652 | Bacteria | 8489 |
| 169 | Ga0466708_351404 | 3300042652 | Bacteria | 7448 |
| 170 | Ga0466727_254679 | 3300042655 | Bacteria | 3275 |
| 171 | Ga0466727_277383 | 3300042655 | Bacteria | 5934 |
| 172 | Ga0123353_10057050 | 3300010167 | Bacteria | 6254 |
| 173 | Ga0466707_076870 | 3300042601 | Bacteria | 6960 |
| 174 | Ga0466707_179989 | 3300042601 | Bacteria | 30155 |
| 175 | Ga0466713_072295 | 3300042602 | Bacteria | 2572 |
| 176 | Ga0466713_085907 | 3300042602 | Bacteria | 11127 |
| 177 | Ga0466719_263547 | 3300042606 | Bacteria | 1905 |
| 178 | Ga0466722_262590 | 3300042609 | Bacteria | 2570 |
| 179 | Ga0466715_172237 | 3300042616 | Bacteria | 4332 |
| 180 | Ga0466723_129136 | 3300042618 | Bacteria | 27423 |
| 181 | Ga0466723_208689 | 3300042618 | Bacteria | 5542 |
| 182 | Ga0466694_408688 | 3300042594 | Bacteria | 1402 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.