Protein Family IF12160

Metagenome Isolate
236 Members
104 Samples
182 Scaffolds
347.43 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820768849|2820769987|
Length
407 aa
Sequence
MATKRDYYEILEVSKTATADEIKKAYRQAALKYHPDKNPGDKAAEEKFKEAAEAYDVLSDADKRARYDQFGHAGMSGAAGGPGGGFSGGGFTMEDIFRNFGDIFGGHFGGGMGGGRGGFSTFEFDMGGMGGGFAGGGGRGGRRVNRGSDLRVKVKLSLKEIANGTTKKLKINKMVTCDKCGGTGAKTPDSYTTCAACNGSGYVTQVVNTIFGRTQSTVQCPTCHGDGRTIKDKCDKCHGEGIVRGEEVVEIKIPAGVGAGMQLSVSGKGNAARHGGVNGDLLVIIEEERHPELERDGSDLLYNLALTIPEAVLGGMVEVPTIEGKAKVKVQPGTVAGQVLRLKGKGIPDLNGYGRGDILAVVDIAVPAKLSADEKRLVEELGRTPSFAKAEKKVRQNIFDRMRSFFR

πŸ“Š Sample Types

Isolate 22.9%
Metagenome 77.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 28.4%
Blattidae 20.6%
Termitidae 19.6%
Kalotermitidae 13.7%
Rhinotermitidae 3.9%
Termopsidae 3.9%
Passalidae 2.9%
Hydrophilidae 2.0%
Panorpidae 1.0%
Hodotermitidae 1.0%
Culicidae 1.0%
Cerambycidae 1.0%
Drosophilidae 1.0%

🌳 Taxonomy

Archaea 1
Bacteria 228
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 2843673047 Spiroplasma alleghenense PLHS-1 Isolate Panorpidae
7 2561511100 Mesoplasma photuris ATCC 49581 Isolate Unclassified
8 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
22 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
23 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
24 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
25 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
26 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
27 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
28 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
32 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2558860238 Spiroplasma sabaudiense Ar-1343 Isolate Culicidae
38 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
39 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
47 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
48 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
49 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
53 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
54 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
55 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
56 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
57 2802429270 Mesoplasma chauliocola CHPA-2 Isolate Unclassified
58 2806310970 Mesoplasma florum MQ3 Isolate Unclassified
59 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
60 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
61 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
62 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
63 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
64 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
65 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
66 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
67 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
68 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
69 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
70 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
71 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
72 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
73 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
74 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
75 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
76 2545555831 Mesoplasma chauliocola ATCC 49578 Isolate Unclassified
77 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
78 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
79 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
80 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
81 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
82 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
83 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
84 2806310895 Mesoplasma florum CnuA-2 Isolate Unclassified
85 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
86 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
87 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
92 2920168565 Paludibacter sp. 221 Isolate Blattidae
93 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
94 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
95 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
96 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
97 2561511101 Mesoplasma grammopterae ATCC 49580 Isolate Cerambycidae
98 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
99 2806310987 Mesoplasma florum BARC 787 Isolate Unclassified
100 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
101 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
102 2773857695 Unclassified Methanosarcinaceae Th196P4bin37 Isolate Unclassified
103 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
104 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_056566 3300042659 Bacteria 66737
2 Ga0466733_145952 3300042659 Bacteria 16748
3 Ga0466703_082463 3300042636 Bacteria 12255
4 Ga0466703_294332 3300042636 Bacteria 3669
5 Ga0466709_306520 3300042648 Bacteria 32391
6 Ga0123355_10001922 3300009826 Unclassified 29203
7 Ga0123356_10008214 3300010049 Bacteria 10388
8 Ga0123353_10150198 3300010167 Bacteria 3720
9 Ga0123353_10457604 3300010167 Bacteria 1876
10 Ga0466706_020182 3300042599 Bacteria 36010
11 Ga0466713_089870 3300042602 Bacteria 67596
12 Ga0466714_027987 3300042603 Bacteria 18048
13 Ga0466716_156121 3300042605 Bacteria 5646
14 Ga0466719_058825 3300042606 Bacteria 4933
15 Ga0466722_000483 3300042609 Bacteria 1365
16 Ga0466722_055335 3300042609 Bacteria 5264
17 Ga0466711_148883 3300042615 Bacteria 17879
18 Ga0466715_040088 3300042616 Bacteria 6104
19 Ga0466728_156927 3300042620 Bacteria 6361
20 2226985928 2225789003 Bacteria 8200
21 JGI24702J35022_10054020 3300002462 Unclassified 2143
22 Ga0068302_10453946 3300005071 Bacteria 1357
23 Ga0068305_10170118 3300005083 Bacteria 3763
24 Ga0072941_1041677 3300005201 Bacteria 14041
25 Ga0466692_108140 3300042591 Bacteria 2436
26 Ga0466696_478533 3300042596 Bacteria 8283
27 Ga0466705_013543 3300042612 Bacteria 4621
28 Ga0466709_221860 3300042648 Bacteria 264751
29 Ga0123357_10014725 3300009784 Bacteria 10221
30 Ga0123357_10019811 3300009784 Bacteria 8979
31 Ga0123356_10000553 3300010049 Bacteria 41455
32 Ga0123353_10065740 3300010167 Bacteria 5822
33 Ga0123353_10384275 3300010167 Bacteria 2098
34 Ga0123354_10130814 3300010882 Bacteria 3171
35 Ga0466706_098738 3300042599 Unclassified 1773
36 Ga0466700_236184 3300042600 Bacteria 3835
37 Ga0466707_033660 3300042601 Bacteria 25263
38 Ga0466713_028910 3300042602 Bacteria 114900
39 Ga0466716_479841 3300042605 Bacteria 3977
40 Ga0466722_205034 3300042609 Bacteria 7070
41 Ga0466722_238358 3300042609 Bacteria 4978
42 Ga0466715_051135 3300042616 Bacteria 47345
43 Ga0466715_177129 3300042616 Bacteria 4142
44 Ga0466728_025982 3300042620 Bacteria 7629
45 Ga0072941_1166719 3300005201 Bacteria 1872
46 Ga0466692_066865 3300042591 Bacteria 168349
47 Ga0466705_032663 3300042612 Bacteria 37888
48 Ga0466733_078804 3300042659 Bacteria 5915
49 Ga0466733_138271 3300042659 Bacteria 8774
50 Ga0466703_292679 3300042636 Bacteria 5245
51 Ga0123355_10000171 3300009826 Bacteria 79083
52 Ga0123356_10008147 3300010049 Bacteria 10434
53 Ga0123353_10000053 3300010167 Bacteria 130089
54 Ga0466706_275748 3300042599 Bacteria 2526
55 Ga0466707_079600 3300042601 Bacteria 16086
56 Ga0466707_316195 3300042601 Bacteria 16187
57 Ga0466713_044001 3300042602 Bacteria 42258
58 Ga0466713_053881 3300042602 Bacteria 5860
59 Ga0466714_092925 3300042603 Bacteria 5260
60 Ga0466714_112288 3300042603 Bacteria 2952
61 Ga0466711_163604 3300042615 Bacteria 13391
62 Ga0466711_512190 3300042615 Unclassified 21377
63 Ga0466715_492108 3300042616 Bacteria 3670
64 Ga0466715_508757 3300042616 Bacteria 23089
65 Ga0466726_258515 3300042619 Bacteria 4146
66 2227275220 2225789004 Bacteria 30751
67 JGI24705J35276_12192432 3300002504 Bacteria 1487
68 Ga0068305_10004729 3300005083 Bacteria 14351
69 Ga0104048_1169770 3300007143 Bacteria 1887
70 Ga0466692_052142 3300042591 Bacteria 15919
71 Ga0466696_466055 3300042596 Bacteria 7375
72 Ga0466733_084798 3300042659 Bacteria 16934
73 Ga0466729_212262 3300042621 Bacteria 7254
74 Ga0466735_144837 3300042624 Bacteria 2075
75 Ga0466735_230218 3300042624 Bacteria 3943
76 Ga0466703_157161 3300042636 Bacteria 4756
77 Ga0466703_179048 3300042636 Bacteria 1528
78 Ga0466704_043571 3300042643 Bacteria 8375
79 Ga0466725_251772 3300042654 Bacteria 19267
80 Ga0123353_10445211 3300010167 Bacteria 1909
81 Ga0466706_225176 3300042599 Bacteria 38857
82 Ga0466700_376010 3300042600 Bacteria 38603
83 Ga0466713_062226 3300042602 Bacteria 23233
84 Ga0466713_089753 3300042602 Bacteria 35618
85 Ga0466716_118575 3300042605 Bacteria 8693
86 Ga0466716_321671 3300042605 Bacteria 3266
87 Ga0466719_566801 3300042606 Bacteria 5443
88 Ga0466722_074555 3300042609 Bacteria 4611
89 Ga0466698_253056 3300042610 Bacteria 1911
90 IMNBL1DRAFT_c0001045 3300000062 Bacteria 21425
91 JGI24695J34938_10001751 3300002450 Bacteria 17958
92 JGI24699J35502_11133994 3300002509 Bacteria 23331
93 JGI24696J40584_12960450 3300002834 Bacteria 7282
94 Ga0068305_10001331 3300005083 Bacteria 81205
95 Ga0466691_086050 3300042593 Bacteria 33199
96 Ga0466705_026614 3300042612 Bacteria 11254
97 Ga0466702_115878 3300042635 Bacteria 4317
98 Ga0466704_042270 3300042643 Unclassified 3952
99 Ga0466709_420512 3300042648 Bacteria 4825
100 Ga0466727_042687 3300042655 Bacteria 90775
101 Ga0466727_224853 3300042655 Bacteria 23233
102 Ga0123357_10083476 3300009784 Bacteria 4193
103 Ga0123355_10000270 3300009826 Bacteria 66244
104 Ga0123353_10583083 3300010167 Bacteria 1604
105 Ga0123354_10032871 3300010882 Bacteria 8125
106 Ga0466707_019758 3300042601 Bacteria 35482
107 Ga0466713_015686 3300042602 Bacteria 17898
108 Ga0466713_150937 3300042602 Bacteria 9507
109 Ga0466714_023328 3300042603 Bacteria 19373
110 Ga0466716_033834 3300042605 Bacteria 1827
111 Ga0466722_045245 3300042609 Bacteria 45507
112 Ga0466711_060142 3300042615 Bacteria 9556
113 Ga0466723_018128 3300042618 Bacteria 12018
114 Ga0466723_126779 3300042618 Bacteria 5695
115 Ga0466726_120635 3300042619 Bacteria 13835
116 2227347458 2225789004 Bacteria 6197
117 IMNBL1DRAFT_c0009480 3300000062 Bacteria 4802
118 JGI24695J34938_10001696 3300002450 Bacteria 18208
119 Ga0068302_10009605 3300005071 Bacteria 4072
120 Ga0466692_094457 3300042591 Bacteria 31045
121 Ga0466692_116427 3300042591 Bacteria 133716
122 Ga0466696_387176 3300042596 Bacteria 50828
123 Ga0466705_189810 3300042612 Bacteria 1965
124 Ga0466709_041946 3300042648 Bacteria 1599
125 Ga0466708_180067 3300042652 Bacteria 29640
126 Ga0123356_10017897 3300010049 Unclassified 6732
127 Ga0123353_10000503 3300010167 Bacteria 48547
128 Ga0466706_013829 3300042599 Bacteria 33879
129 Ga0466706_154397 3300042599 Bacteria 3613
130 Ga0466706_200536 3300042599 Bacteria 17217
131 Ga0466714_155625 3300042603 Bacteria 2103
132 Ga0466710_415330 3300042613 Bacteria 3083
133 Ga0466711_058883 3300042615 Bacteria 2317
134 Ga0466728_029017 3300042620 Bacteria 35653
135 JGI24702J35022_10000511 3300002462 Bacteria 23507
136 JGI24702J35022_10034105 3300002462 Bacteria 2722
137 Ga0466690_047506 3300042590 Bacteria 2212
138 Ga0466691_076870 3300042593 Bacteria 6717
139 Ga0466691_132978 3300042593 Bacteria 2228
140 Ga0466696_215941 3300042596 Bacteria 8391
141 Ga0466703_014538 3300042636 Bacteria 89399
142 Ga0466704_352277 3300042643 Bacteria 13970
143 Ga0466709_260200 3300042648 Bacteria 17443
144 Ga0466708_072667 3300042652 Bacteria 28691
145 Ga0466725_096755 3300042654 Bacteria 21543
146 Ga0123357_10149267 3300009784 Bacteria 2843
147 Ga0123356_10031534 3300010049 Bacteria 4959
148 Ga0123354_10001224 3300010882 Bacteria 30412
149 Ga0123354_10313968 3300010882 Bacteria 1458
150 Ga0466701_034936 3300042598 Bacteria 51193
151 Ga0466707_235618 3300042601 Bacteria 12371
152 Ga0466713_031330 3300042602 Bacteria 95179
153 Ga0466714_135420 3300042603 Bacteria 3261
154 Ga0466716_114977 3300042605 Bacteria 23750
155 Ga0466698_067901 3300042610 Bacteria 1694
156 Ga0466698_406596 3300042610 Bacteria 4626
157 Ga0466723_236631 3300042618 Bacteria 23560
158 IMNBL1DRAFT_c0001881 3300000062 Bacteria 15279
159 Ga0068302_10077713 3300005071 Unclassified 4203
160 Ga0072941_1370258 3300005201 Bacteria 2049
161 Ga0466657_329353 3300042582 Bacteria 8232
162 Ga0466690_379955 3300042590 Bacteria 6183
163 Ga0466690_401381 3300042590 Bacteria 6397
164 Ga0466692_032866 3300042591 Bacteria 37963
165 Ga0466705_206919 3300042612 Bacteria 17345
166 Ga0466704_085703 3300042643 Bacteria 3180
167 Ga0466709_340185 3300042648 Bacteria 22865
168 Ga0466708_254920 3300042652 Bacteria 8489
169 Ga0466708_351404 3300042652 Bacteria 7448
170 Ga0466727_254679 3300042655 Bacteria 3275
171 Ga0466727_277383 3300042655 Bacteria 5934
172 Ga0123353_10057050 3300010167 Bacteria 6254
173 Ga0466707_076870 3300042601 Bacteria 6960
174 Ga0466707_179989 3300042601 Bacteria 30155
175 Ga0466713_072295 3300042602 Bacteria 2572
176 Ga0466713_085907 3300042602 Bacteria 11127
177 Ga0466719_263547 3300042606 Bacteria 1905
178 Ga0466722_262590 3300042609 Bacteria 2570
179 Ga0466715_172237 3300042616 Bacteria 4332
180 Ga0466723_129136 3300042618 Bacteria 27423
181 Ga0466723_208689 3300042618 Bacteria 5542
182 Ga0466694_408688 3300042594 Bacteria 1402

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00226 DnaJ DnaJ domain 6 68 0.99
PF01556 DnaJ_C DnaJ C terminal domain 150 367 0.98
PF00684 DnaJ_CXXCXGXG DnaJ central domain 177 241 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.