Protein Family IF12147
Metagenome
Isolate
423
Members
148
Samples
358
Scaffolds
241.07
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820741847|2820742466|
- Length
- 286 aa
- Sequence
- MGQKVNPISNRLGIIKGWDSNWYGGKNYGDKLVEDSKIRKYLNARLAKASLSRIIIERTLKLITVTVLTARPGLIIGKGGTEVDKLKEELKKITDKEVQINIFEVKKPELDALIVANNIARQLEGRIPYRRAVKTAIASTMRMGADGIKVLISGRLNGAEMARSEMYKEGRTPLHTFRADIDYARAEALTKTGLLGLKVWICKGEIYGKPDLAPNYAQKEMNMGPVGMNRKREQPRGDGGFKRDRDRDWDRGDRGSRDRTDNRDRDNRGGGGGGGFRKDKNNRYKR
Sample Types
Isolate
15.4%
Metagenome
84.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
24.1%
Termitidae
22.0%
Unclassified
11.3%
Kalotermitidae
9.9%
Formicidae
7.8%
Rhinotermitidae
4.3%
Apidae
2.8%
Termopsidae
2.8%
Elmidae
2.1%
Drosophilidae
2.1%
Armadillidiidae
2.1%
Hydrophilidae
1.4%
Tenebrionidae
1.4%
Culicidae
1.4%
Passalidae
1.4%
Hodotermitidae
0.7%
Daphniidae
0.7%
Aphididae
0.7%
Cambaridae
0.7%
Taxonomy
Archaea
0
Bacteria
391
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 2 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 3 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 4 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 5 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 6 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 7 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 8 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 13 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 14 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 15 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 16 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 32 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 33 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 34 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 35 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 36 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 37 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 38 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 39 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 52 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 53 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 54 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 55 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 56 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 57 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 58 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 59 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 60 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 61 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 62 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 66 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 67 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 68 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 69 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 70 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 71 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 72 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 73 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 74 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 75 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 76 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 77 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 78 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 79 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 80 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 81 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 82 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 83 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 84 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 85 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 86 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 87 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 88 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 89 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 90 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 91 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 92 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 93 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 94 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 95 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 96 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 97 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 98 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 99 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 100 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 101 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 102 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 103 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 104 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 105 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 106 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 107 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 108 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 109 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 110 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 111 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 112 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 113 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 114 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 115 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 116 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 117 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 118 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 119 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 120 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 121 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 122 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 123 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 124 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 125 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 126 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 127 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 128 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 129 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 130 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 131 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 132 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 133 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 134 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 135 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 136 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 137 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 138 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 139 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 140 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 141 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 142 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 143 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 144 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 145 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 146 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 147 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 148 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_227068 | 3300042611 | Bacteria | 1055 |
| 2 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 3 | Ga0466705_292562 | 3300042612 | Unclassified | 3911 |
| 4 | Ga0466701_089532 | 3300042598 | Bacteria | 1054 |
| 5 | Ga0466706_128949 | 3300042599 | Bacteria | 3593 |
| 6 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 7 | Ga0466706_264266 | 3300042599 | Bacteria | 6035 |
| 8 | Ga0466700_224480 | 3300042600 | Bacteria | 5875 |
| 9 | Ga0466707_335285 | 3300042601 | Bacteria | 3641 |
| 10 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 11 | Ga0466714_060717 | 3300042603 | Bacteria | 4570 |
| 12 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 13 | Ga0466716_231031 | 3300042605 | Bacteria | 6941 |
| 14 | Ga0466721_334377 | 3300042608 | Bacteria | 1058 |
| 15 | Ga0466721_383913 | 3300042608 | Bacteria | 2666 |
| 16 | Ga0466735_177951 | 3300042624 | Bacteria | 10162 |
| 17 | Ga0466730_092767 | 3300042625 | Unclassified | 1173 |
| 18 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 19 | Ga0466703_023022 | 3300042636 | Unclassified | 1483 |
| 20 | Ga0466704_106414 | 3300042643 | Bacteria | 2494 |
| 21 | Ga0466704_441700 | 3300042643 | Bacteria | 20268 |
| 22 | Ga0466708_012925 | 3300042652 | Bacteria | 7826 |
| 23 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 24 | Ga0466723_023434 | 3300042618 | Bacteria | 4582 |
| 25 | Ga0466729_167874 | 3300042621 | Bacteria | 5275 |
| 26 | Ga0466656_071907 | 3300042550 | Bacteria | 2007 |
| 27 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 28 | Ga0466690_168212 | 3300042590 | Bacteria | 11803 |
| 29 | Ga0466692_144683 | 3300042591 | Bacteria | 28602 |
| 30 | Ga0466693_446615 | 3300042592 | Unclassified | 1366 |
| 31 | Ga0466691_003678 | 3300042593 | Bacteria | 14150 |
| 32 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 33 | Ga0466699_156841 | 3300042597 | Unclassified | 2212 |
| 34 | 2227108587 | 2225789004 | Bacteria | 37724 |
| 35 | JGI24702J35022_10023308 | 3300002462 | Bacteria | 3347 |
| 36 | JGI24705J35276_12223779 | 3300002504 | Bacteria | 2543 |
| 37 | JGI24705J35276_12235555 | 3300002504 | Unclassified | 6670 |
| 38 | Ga0102734_1000004 | 3300007129 | Bacteria | 74698 |
| 39 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 40 | Ga0466707_157624 | 3300042601 | Bacteria | 13208 |
| 41 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 42 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 43 | Ga0466714_028665 | 3300042603 | Bacteria | 5560 |
| 44 | Ga0466717_104945 | 3300042604 | Bacteria | 7422 |
| 45 | Ga0466717_251298 | 3300042604 | Bacteria | 1954 |
| 46 | Ga0466716_310970 | 3300042605 | Bacteria | 3334 |
| 47 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 48 | Ga0466722_066942 | 3300042609 | Unclassified | 3063 |
| 49 | Ga0466698_327264 | 3300042610 | Bacteria | 8551 |
| 50 | Ga0466698_392141 | 3300042610 | Bacteria | 2397 |
| 51 | Ga0466702_138136 | 3300042635 | Unclassified | 1906 |
| 52 | Ga0466703_174311 | 3300042636 | Bacteria | 11934 |
| 53 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 54 | Ga0466708_050057 | 3300042652 | Bacteria | 16124 |
| 55 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 56 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 57 | Ga0123357_10353222 | 3300009784 | Unclassified | 1403 |
| 58 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 59 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 60 | Ga0466715_209992 | 3300042616 | Bacteria | 7477 |
| 61 | Ga0466723_082479 | 3300042618 | Bacteria | 5238 |
| 62 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 63 | Ga0466726_069100 | 3300042619 | Bacteria | 5355 |
| 64 | Ga0466726_411131 | 3300042619 | Bacteria | 1738 |
| 65 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 66 | Ga0466729_106187 | 3300042621 | Bacteria | 19633 |
| 67 | Ga0466729_112686 | 3300042621 | Bacteria | 10506 |
| 68 | Ga0160457_1000213 | 3300012858 | Bacteria | 44531 |
| 69 | Ga0466657_244577 | 3300042582 | Bacteria | 1112 |
| 70 | Ga0466657_360416 | 3300042582 | Bacteria | 25893 |
| 71 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 72 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 73 | Ga0466692_100902 | 3300042591 | Bacteria | 68262 |
| 74 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 75 | Ga0466691_212240 | 3300042593 | Bacteria | 8980 |
| 76 | Ga0466694_199604 | 3300042594 | Bacteria | 2884 |
| 77 | Ga0466696_053373 | 3300042596 | Bacteria | 10309 |
| 78 | 2227627711 | 2225789004 | Bacteria | 2144 |
| 79 | IMNBL1DRAFT_c0004898 | 3300000062 | Bacteria | 7855 |
| 80 | JGI24702J35022_10015205 | 3300002462 | Bacteria | 4239 |
| 81 | Ga0102739_1000034 | 3300007095 | Bacteria | 41545 |
| 82 | Ga0103267_1000365 | 3300007190 | Bacteria | 19591 |
| 83 | Ga0103268_1000147 | 3300007192 | Unclassified | 23312 |
| 84 | Ga0105005_1050571 | 3300007505 | Unclassified | 1596 |
| 85 | Ga0466697_159381 | 3300042611 | Bacteria | 3322 |
| 86 | Ga0466697_180424 | 3300042611 | Unclassified | 1828 |
| 87 | Ga0466733_098636 | 3300042659 | Bacteria | 1712 |
| 88 | Ga0466733_145814 | 3300042659 | Bacteria | 7169 |
| 89 | Ga0466706_149351 | 3300042599 | Bacteria | 2494 |
| 90 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 91 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 92 | Ga0466697_010194 | 3300042611 | Bacteria | 1999 |
| 93 | Ga0466735_218590 | 3300042624 | Bacteria | 5407 |
| 94 | Ga0466735_221921 | 3300042624 | Bacteria | 30703 |
| 95 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 96 | Ga0466704_387164 | 3300042643 | Unclassified | 2490 |
| 97 | Ga0466709_120352 | 3300042648 | Bacteria | 2525 |
| 98 | Ga0123357_10148486 | 3300009784 | Unclassified | 2854 |
| 99 | Ga0123353_10027541 | 3300010167 | Bacteria | 8712 |
| 100 | Ga0123354_10000176 | 3300010882 | Bacteria | 53249 |
| 101 | Ga0466711_025270 | 3300042615 | Bacteria | 4616 |
| 102 | Ga0466711_052952 | 3300042615 | Bacteria | 10990 |
| 103 | Ga0466711_212221 | 3300042615 | Bacteria | 10563 |
| 104 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 105 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 106 | Ga0466715_533905 | 3300042616 | Bacteria | 9746 |
| 107 | Ga0466715_643493 | 3300042616 | Bacteria | 6621 |
| 108 | Ga0466723_068064 | 3300042618 | Bacteria | 4624 |
| 109 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 110 | Ga0466728_071780 | 3300042620 | Bacteria | 4317 |
| 111 | Ga0466728_105299 | 3300042620 | Bacteria | 55474 |
| 112 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 113 | Ga0160455_100183 | 3300012837 | Bacteria | 61401 |
| 114 | Ga0466692_138247 | 3300042591 | Unclassified | 1529 |
| 115 | Ga0466696_147649 | 3300042596 | Bacteria | 7322 |
| 116 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 117 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 118 | IMNBL1DRAFT_c0000282 | 3300000062 | Bacteria | 44672 |
| 119 | IMNBL1DRAFT_c0000687 | 3300000062 | Bacteria | 27159 |
| 120 | IMNBL1DRAFT_c0033498 | 3300000062 | Bacteria | 1838 |
| 121 | JGI24702J35022_10004653 | 3300002462 | Bacteria | 8123 |
| 122 | Ga0068302_10026211 | 3300005071 | Bacteria | 2263 |
| 123 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 124 | Ga0103267_1000167 | 3300007190 | Bacteria | 33708 |
| 125 | Ga0466733_017210 | 3300042659 | Bacteria | 20046 |
| 126 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 127 | Ga0466733_043260 | 3300042659 | Bacteria | 38032 |
| 128 | Ga0466706_028809 | 3300042599 | Bacteria | 4017 |
| 129 | Ga0466706_082645 | 3300042599 | Bacteria | 7494 |
| 130 | Ga0466706_174091 | 3300042599 | Bacteria | 1696 |
| 131 | Ga0466706_206897 | 3300042599 | Bacteria | 23157 |
| 132 | Ga0466707_370942 | 3300042601 | Bacteria | 1207 |
| 133 | Ga0466713_131330 | 3300042602 | Bacteria | 1587 |
| 134 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 135 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 136 | Ga0466731_037854 | 3300042622 | Bacteria | 3364 |
| 137 | Ga0466735_004745 | 3300042624 | Bacteria | 2961 |
| 138 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 139 | Ga0466703_186612 | 3300042636 | Unclassified | 1495 |
| 140 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 141 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 142 | Ga0466703_301572 | 3300042636 | Bacteria | 1434 |
| 143 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 144 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 145 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 146 | Ga0466709_129005 | 3300042648 | Bacteria | 13583 |
| 147 | Ga0466709_356044 | 3300042648 | Bacteria | 4031 |
| 148 | Ga0466727_289772 | 3300042655 | Bacteria | 14123 |
| 149 | Ga0123357_10030639 | 3300009784 | Bacteria | 7293 |
| 150 | Ga0123356_10069721 | 3300010049 | Bacteria | 3297 |
| 151 | Ga0123356_10228329 | 3300010049 | Bacteria | 1924 |
| 152 | Ga0123354_10040605 | 3300010882 | Bacteria | 7198 |
| 153 | Ga0123354_10067769 | 3300010882 | Bacteria | 5194 |
| 154 | Ga0123354_10154150 | 3300010882 | Unclassified | 2766 |
| 155 | Ga0160465_100010 | 3300012803 | Bacteria | 359268 |
| 156 | Ga0466711_409453 | 3300042615 | Bacteria | 2405 |
| 157 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 158 | Ga0466726_064923 | 3300042619 | Bacteria | 35500 |
| 159 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 160 | Ga0160456_106555 | 3300012820 | Bacteria | 1342 |
| 161 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 162 | Ga0466690_418489 | 3300042590 | Unclassified | 1250 |
| 163 | Ga0466692_159524 | 3300042591 | Bacteria | 46807 |
| 164 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 165 | 2227505183 | 2225789004 | Bacteria | 18874 |
| 166 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 167 | JGI24702J35022_10008763 | 3300002462 | Bacteria | 5711 |
| 168 | JGI24696J40584_12944767 | 3300002834 | Bacteria | 1825 |
| 169 | CVPL010W_10003963 | 3300002931 | Bacteria | 18555 |
| 170 | Ga0068302_10187713 | 3300005071 | Bacteria | 5235 |
| 171 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 172 | Ga0072941_1102373 | 3300005201 | Bacteria | 3441 |
| 173 | Ga0103265_1000086 | 3300007068 | Bacteria | 18456 |
| 174 | Ga0102740_1000105 | 3300007140 | Unclassified | 21288 |
| 175 | Ga0127649_100060 | 3300009460 | Bacteria | 50841 |
| 176 | Ga0466733_220977 | 3300042659 | Bacteria | 23380 |
| 177 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 178 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 179 | Ga0466706_064752 | 3300042599 | Unclassified | 1599 |
| 180 | Ga0466706_098228 | 3300042599 | Bacteria | 39742 |
| 181 | Ga0466707_230802 | 3300042601 | Bacteria | 16904 |
| 182 | Ga0466707_372914 | 3300042601 | Bacteria | 4317 |
| 183 | Ga0466713_017147 | 3300042602 | Bacteria | 4646 |
| 184 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 185 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 186 | Ga0466717_224632 | 3300042604 | Bacteria | 2047 |
| 187 | Ga0466716_122468 | 3300042605 | Bacteria | 22074 |
| 188 | Ga0466716_397647 | 3300042605 | Bacteria | 6519 |
| 189 | Ga0466719_025390 | 3300042606 | Bacteria | 13141 |
| 190 | Ga0466719_348164 | 3300042606 | Bacteria | 5381 |
| 191 | Ga0466722_066697 | 3300042609 | Bacteria | 1006 |
| 192 | Ga0466734_003771 | 3300042623 | Bacteria | 4944 |
| 193 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 194 | Ga0466704_004444 | 3300042643 | Bacteria | 24992 |
| 195 | Ga0466704_134293 | 3300042643 | Bacteria | 13368 |
| 196 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
| 197 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 198 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 199 | Ga0466727_282387 | 3300042655 | Bacteria | 2925 |
| 200 | Ga0160471_100005 | 3300012812 | Bacteria | 554359 |
| 201 | Ga0466711_067172 | 3300042615 | Bacteria | 5964 |
| 202 | Ga0466711_139501 | 3300042615 | Bacteria | 14201 |
| 203 | Ga0466711_248608 | 3300042615 | Bacteria | 5371 |
| 204 | Ga0466715_024383 | 3300042616 | Bacteria | 26866 |
| 205 | Ga0466715_154449 | 3300042616 | Bacteria | 23802 |
| 206 | Ga0466726_293348 | 3300042619 | Bacteria | 4805 |
| 207 | Ga0466729_176017 | 3300042621 | Unclassified | 2217 |
| 208 | Ga0466656_342527 | 3300042550 | Bacteria | 1405 |
| 209 | Ga0466690_248799 | 3300042590 | Bacteria | 9265 |
| 210 | Ga0466693_159396 | 3300042592 | Bacteria | 2965 |
| 211 | Ga0466693_347921 | 3300042592 | Unclassified | 1828 |
| 212 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 213 | Ga0466696_344663 | 3300042596 | Bacteria | 1337 |
| 214 | IMNBL1DRAFT_c0002428 | 3300000062 | Bacteria | 12971 |
| 215 | JGI24695J34938_10021047 | 3300002450 | Bacteria | 3199 |
| 216 | JGI24702J35022_10002652 | 3300002462 | Bacteria | 10856 |
| 217 | JGI24702J35022_10004800 | 3300002462 | Bacteria | 7988 |
| 218 | JGI24702J35022_10124849 | 3300002462 | Unclassified | 1424 |
| 219 | JGI24699J35502_11133712 | 3300002509 | Bacteria | 14056 |
| 220 | JGI24696J40584_12961337 | 3300002834 | Bacteria | 13784 |
| 221 | Ga0102735_1000172 | 3300007080 | Bacteria | 22744 |
| 222 | Ga0104048_1021918 | 3300007143 | Bacteria | 2053 |
| 223 | Ga0104050_1209257 | 3300007153 | Bacteria | 1029 |
| 224 | Ga0103264_1000100 | 3300007188 | Bacteria | 49857 |
| 225 | Ga0466697_273708 | 3300042611 | Unclassified | 1141 |
| 226 | Ga0466705_375741 | 3300042612 | Bacteria | 24449 |
| 227 | Ga0466733_108315 | 3300042659 | Bacteria | 2931 |
| 228 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 229 | Ga0466717_145500 | 3300042604 | Unclassified | 1878 |
| 230 | Ga0466719_504884 | 3300042606 | Bacteria | 4012 |
| 231 | Ga0466722_033596 | 3300042609 | Bacteria | 3777 |
| 232 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 233 | Ga0466729_241472 | 3300042621 | Bacteria | 12387 |
| 234 | Ga0466730_074662 | 3300042625 | Bacteria | 3234 |
| 235 | Ga0466730_084715 | 3300042625 | Bacteria | 2994 |
| 236 | Ga0466703_005226 | 3300042636 | Bacteria | 3628 |
| 237 | Ga0466703_174375 | 3300042636 | Bacteria | 10269 |
| 238 | Ga0466704_300588 | 3300042643 | Bacteria | 28806 |
| 239 | Ga0466709_208437 | 3300042648 | Bacteria | 82349 |
| 240 | Ga0466725_349608 | 3300042654 | Bacteria | 3039 |
| 241 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 242 | Ga0123353_10016319 | 3300010167 | Bacteria | 10850 |
| 243 | Ga0466710_200734 | 3300042613 | Bacteria | 4049 |
| 244 | Ga0466710_234950 | 3300042613 | Bacteria | 1572 |
| 245 | Ga0466715_324314 | 3300042616 | Bacteria | 25350 |
| 246 | Ga0466715_440169 | 3300042616 | Bacteria | 7303 |
| 247 | Ga0466718_057557 | 3300042617 | Bacteria | 1302 |
| 248 | Ga0466723_198099 | 3300042618 | Bacteria | 9283 |
| 249 | Ga0466723_234180 | 3300042618 | Unclassified | 1340 |
| 250 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 251 | Ga0160441_100072 | 3300012825 | Bacteria | 130977 |
| 252 | Ga0466657_106830 | 3300042582 | Bacteria | 4958 |
| 253 | Ga0466657_280446 | 3300042582 | Unclassified | 1287 |
| 254 | Ga0466690_085259 | 3300042590 | Bacteria | 7863 |
| 255 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 256 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 257 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 258 | Ga0466695_272796 | 3300042595 | Bacteria | 4403 |
| 259 | Ga0466696_283703 | 3300042596 | Bacteria | 19581 |
| 260 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 261 | IMNBL1DRAFT_c0000682 | 3300000062 | Bacteria | 27226 |
| 262 | JGI24702J35022_10000437 | 3300002462 | Bacteria | 25160 |
| 263 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 264 | Ga0068305_10003312 | 3300005083 | Bacteria | 66359 |
| 265 | Ga0102734_1000226 | 3300007129 | Bacteria | 17504 |
| 266 | Ga0102737_1000052 | 3300007142 | Bacteria | 34662 |
| 267 | Ga0103267_1000029 | 3300007190 | Bacteria | 51888 |
| 268 | Ga0103268_1000539 | 3300007192 | Bacteria | 11296 |
| 269 | Ga0105005_1012474 | 3300007505 | Bacteria | 2253 |
| 270 | Ga0123357_10000278 | 3300009784 | Bacteria | 48976 |
| 271 | Ga0466705_089766 | 3300042612 | Bacteria | 11993 |
| 272 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 273 | Ga0466733_189296 | 3300042659 | Bacteria | 1361 |
| 274 | Ga0466701_036012 | 3300042598 | Bacteria | 5947 |
| 275 | Ga0466706_116296 | 3300042599 | Unclassified | 1170 |
| 276 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 277 | Ga0466700_279311 | 3300042600 | Bacteria | 1011 |
| 278 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 279 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 280 | Ga0466713_065587 | 3300042602 | Bacteria | 1100 |
| 281 | Ga0466716_248006 | 3300042605 | Bacteria | 34292 |
| 282 | Ga0466720_070035 | 3300042607 | Bacteria | 2421 |
| 283 | Ga0466734_168927 | 3300042623 | Bacteria | 2289 |
| 284 | Ga0466735_131318 | 3300042624 | Bacteria | 2054 |
| 285 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 286 | Ga0466704_019718 | 3300042643 | Unclassified | 1304 |
| 287 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 288 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 289 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 290 | Ga0123356_10361743 | 3300010049 | Unclassified | 1578 |
| 291 | Ga0123356_10372640 | 3300010049 | Bacteria | 1558 |
| 292 | Ga0123353_10398085 | 3300010167 | Bacteria | 2051 |
| 293 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 294 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 295 | Ga0466711_226259 | 3300042615 | Bacteria | 4193 |
| 296 | Ga0466711_486497 | 3300042615 | Bacteria | 6767 |
| 297 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 298 | Ga0466726_013269 | 3300042619 | Bacteria | 5620 |
| 299 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 300 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 301 | Ga0466726_449817 | 3300042619 | Bacteria | 3569 |
| 302 | Ga0160430_101840 | 3300012852 | Unclassified | 7346 |
| 303 | Ga0160448_107140 | 3300012854 | Unclassified | 2708 |
| 304 | Ga0466691_066359 | 3300042593 | Bacteria | 26336 |
| 305 | Ga0466695_330687 | 3300042595 | Bacteria | 7524 |
| 306 | 2227491320 | 2225789004 | Bacteria | 4075 |
| 307 | IMNBL1DRAFT_c0006755 | 3300000062 | Bacteria | 6199 |
| 308 | JGI24702J35022_10015605 | 3300002462 | Bacteria | 4175 |
| 309 | JGI24702J35022_10015899 | 3300002462 | Bacteria | 4132 |
| 310 | JGI24702J35022_10062811 | 3300002462 | Bacteria | 1990 |
| 311 | Ga0068302_10021088 | 3300005071 | Bacteria | 2464 |
| 312 | Ga0068302_10124393 | 3300005071 | Bacteria | 5305 |
| 313 | Ga0072941_1102374 | 3300005201 | Bacteria | 13675 |
| 314 | Ga0102736_1000046 | 3300007052 | Bacteria | 35527 |
| 315 | Ga0103267_1000475 | 3300007190 | Bacteria | 22560 |
| 316 | Ga0466733_122912 | 3300042659 | Bacteria | 8689 |
| 317 | Ga0466701_049872 | 3300042598 | Bacteria | 8970 |
| 318 | Ga0466706_183911 | 3300042599 | Bacteria | 19618 |
| 319 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 320 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 321 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 322 | Ga0466716_421670 | 3300042605 | Bacteria | 3858 |
| 323 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 324 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 325 | Ga0466719_381451 | 3300042606 | Bacteria | 3784 |
| 326 | Ga0466734_083645 | 3300042623 | Bacteria | 3512 |
| 327 | Ga0466735_190274 | 3300042624 | Bacteria | 11739 |
| 328 | Ga0466703_180446 | 3300042636 | Bacteria | 15145 |
| 329 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 330 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 331 | Ga0466709_206429 | 3300042648 | Bacteria | 3179 |
| 332 | Ga0466709_217396 | 3300042648 | Bacteria | 210619 |
| 333 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 334 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 335 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 336 | Ga0466727_064420 | 3300042655 | Bacteria | 3976 |
| 337 | Ga0466727_331622 | 3300042655 | Bacteria | 5773 |
| 338 | Ga0123357_10068381 | 3300009784 | Bacteria | 4725 |
| 339 | Ga0123356_10036671 | 3300010049 | Bacteria | 4578 |
| 340 | Ga0123356_10067277 | 3300010049 | Bacteria | 3356 |
| 341 | Ga0123353_10151786 | 3300010167 | Bacteria | 3698 |
| 342 | Ga0466710_270487 | 3300042613 | Bacteria | 1528 |
| 343 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 344 | Ga0466715_265725 | 3300042616 | Bacteria | 12007 |
| 345 | Ga0466715_413291 | 3300042616 | Bacteria | 16037 |
| 346 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 347 | Ga0466726_037110 | 3300042619 | Bacteria | 18134 |
| 348 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 349 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 350 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 351 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 352 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 353 | Ga0466696_057464 | 3300042596 | Bacteria | 6383 |
| 354 | Ga0466696_436433 | 3300042596 | Bacteria | 22667 |
| 355 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 356 | JGI24705J35276_12237141 | 3300002504 | Bacteria | 9947 |
| 357 | Ga0068305_10043866 | 3300005083 | Bacteria | 3860 |
| 358 | Ga0103267_1000251 | 3300007190 | Bacteria | 20440 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07650 | GO:0003723 | RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.