Protein Family IF12137

Metagenome Isolate
153 Members
89 Samples
94 Scaffolds
410.83 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820698910|2820701525|
Length
459 aa
Sequence
LAVLYLTAMALIYISLSGIFPHIIPQILCKTIAQPLYWRLDANSKKKAVINMDNARLKKYAELLVRSGGNVQKGQVVVIGCSVDDAYFGRLVQECAYDAGASEVVMDWGDEASARAKFLRADDGIFDDFPQWKVDWYKHYDDKGAVYLRVSSTDPDYLAGVDPNRLRRFSKASGIATKAHSAIMMSNTNRWSVCAIPSPAWAKKVFPNVSEEEAMEKLWAAILKGARADGDNPQTDWEKHKDNFTDRVEYLNKMNFDSLRITTGLGTDITLGLVKNHVWVGGGDTGKDGVPFFPNLPTEEIFTMPDRTRANGRVVASMPLSRMGNLIEGFEMTFKDGLVDSFKAEKNEQALADMLGMDEGAKRLGEVALVTNSSPIGQMGVLFYNTLFDENASAHLALGKAYPNNMKGGDDMTTEKLVEAGGNDSLIHVDFMFGTADMKVIGIGADGTETVFFDNGEFI

📊 Sample Types

Isolate 38.6%
Metagenome 61.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.7%
Termitidae 16.3%
Blattidae 9.3%
Tenebrionidae 5.8%
Kalotermitidae 5.8%
Formicidae 4.7%
Psyllidae 3.5%
Termopsidae 2.3%
Passalidae 1.2%
Dytiscidae 1.2%
Elmidae 1.2%
Daphniidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
2 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
3 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
4 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
5 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
6 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
7 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
8 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
9 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
12 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
13 8063680480 Candidatus Liberibacter asiaticus CoFLP Isolate Psyllidae
14 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
15 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
16 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
17 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
18 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
19 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
20 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
21 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
22 8012112996 Staphylococcus muscae ATCC 49910 Isolate
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
27 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
28 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
29 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
30 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
31 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
32 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
33 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
38 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
39 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
40 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
41 644736336 Candidatus Liberibacter asiaticus psy62 Isolate Psyllidae
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
45 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
46 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
47 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
52 8112490586 Staphylococcus muscae CCM 4175 Isolate
53 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
54 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
55 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
56 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
57 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
58 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
59 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
60 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
61 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
62 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
63 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
64 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
65 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
66 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
67 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
68 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
69 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
70 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
71 2816332302 Candidatus Liberibacter asiaticus YCPsy Isolate Psyllidae
72 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
73 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
74 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
75 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
76 2556921669 Shinella sp. DD12 Isolate Daphniidae
77 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
78 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
79 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
80 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
81 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
82 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
83 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
84 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
85 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
86 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
87 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
88 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
89 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0081 3300056842 Bacteria 350212
2 Ga0123355_10010515 3300009826 Bacteria 14195
3 Ga0123355_10017072 3300009826 Unclassified 11460
4 Ga0415639_011760 3300038395 Bacteria 16179
5 Ga0466699_389868 3300042597 Bacteria 3048
6 CVPL005L_10005166 3300002938 Bacteria 19061
7 Ga0562379_3216 3300056790 Bacteria 11383
8 Ga0466713_052457 3300042602 Bacteria 82842
9 Ga0123355_10000255 3300009826 Bacteria 68435
10 Ga0123355_10062957 3300009826 Bacteria 5985
11 Ga0123355_10341665 3300009826 Bacteria 1993
12 Ga0123353_10062218 3300010167 Unclassified 5987
13 IMNBL1DRAFT_c0001812 3300000062 Bacteria 15549
14 JGI24695J34938_10009135 3300002450 Bacteria 5544
15 JGI24703J35330_11747492 3300002501 Bacteria 7059
16 JGI24700J35501_10930579 3300002508 Bacteria 16090
17 JGI24700J35501_10930588 3300002508 Bacteria 16289
18 Ga0466716_160218 3300042605 Bacteria 6504
19 Ga0123355_10000001 3300009826 Bacteria 286680
20 Ga0123355_10008185 3300009826 Bacteria 15792
21 Ga0123355_10034795 3300009826 Bacteria 8188
22 Ga0123353_10594395 3300010167 Bacteria 1584
23 Ga0415639_026801 3300038395 Bacteria 1870
24 Ga0562379_2857 3300056790 Bacteria 13037
25 Ga0562377_0212 3300056842 Unclassified 147500
26 Ga0562376_0228 3300056857 Unclassified 112204
27 Ga0562374_0219 3300057007 Unclassified 121362
28 Ga0123355_10000617 3300009826 Bacteria 48065
29 Ga0123355_10006824 3300009826 Bacteria 16988
30 Ga0123355_10030183 3300009826 Bacteria 8784
31 Ga0123355_10032238 3300009826 Bacteria 8504
32 Ga0123355_10086852 3300009826 Bacteria 4973
33 Ga0123355_10245157 3300009826 Bacteria 2531
34 Ga0123355_10295880 3300009826 Bacteria 2214
35 Ga0123353_10019182 3300010167 Bacteria 10148
36 Ga0466715_582019 3300042616 Bacteria 46223
37 Ga0466702_405196 3300042635 Bacteria 7505
38 Ga0466725_250362 3300042654 Bacteria 9440
39 JGI24703J35330_11746919 3300002501 Unclassified 5837
40 JGI24703J35330_11747912 3300002501 Unclassified 9019
41 Ga0466705_072494 3300042612 Bacteria 10573
42 Ga0562377_0253 3300056842 Unclassified 122534
43 Ga0466714_004038 3300042603 Bacteria 9106
44 Ga0466716_423511 3300042605 Bacteria 3385
45 Ga0123355_10000088 3300009826 Bacteria 97566
46 Ga0123355_10000089 3300009826 Bacteria 96529
47 Ga0123355_10000202 3300009826 Bacteria 74240
48 Ga0123355_10024194 3300009826 Bacteria 9757
49 Ga0123353_10000107 3300010167 Bacteria 96760
50 Ga0466711_487741 3300042615 Bacteria 9918
51 Ga0466734_010718 3300042623 Bacteria 5417
52 JGI24695J34938_10000532 3300002450 Unclassified 36923
53 JGI24700J35501_10930408 3300002508 Bacteria 13706
54 Ga0068305_10008203 3300005083 Bacteria 12453
55 Ga0562374_2014 3300057007 Unclassified 20335
56 Ga0123355_10000234 3300009826 Bacteria 70892
57 Ga0123355_10000288 3300009826 Bacteria 64439
58 Ga0123355_10003011 3300009826 Bacteria 24006
59 Ga0123355_10034002 3300009826 Bacteria 8279
60 Ga0123355_10041254 3300009826 Bacteria 7514
61 Ga0123355_10283672 3300009826 Bacteria 2283
62 Ga0415639_013507 3300038395 Bacteria 6373
63 Ga0415639_049943 3300038395 Bacteria 8080
64 JGI24695J34938_10000434 3300002450 Bacteria 40326
65 JGI24695J34938_10002555 3300002450 Unclassified 13719
66 JGI24695J34938_10060878 3300002450 Unclassified 1609
67 JGI24703J35330_11748212 3300002501 Bacteria 12082
68 CVPL010L_1000001 3300002932 Bacteria 547858
69 Ga0123357_10004560 3300009784 Unclassified 16312
70 Ga0123355_10000118 3300009826 Bacteria 90212
71 Ga0123355_10009724 3300009826 Bacteria 14660
72 Ga0123355_10220192 3300009826 Bacteria 2731
73 Ga0160453_100308 3300012814 Bacteria 43594
74 Ga0466693_059568 3300042592 Bacteria 2579
75 Ga0466696_446555 3300042596 Bacteria 1829
76 Ga0102738_1000013 3300007141 Bacteria 98326
77 Ga0562377_0281 3300056842 Bacteria 109788
78 Ga0562374_0113 3300057007 Unclassified 206970
79 Ga0562374_0156 3300057007 Unclassified 158989
80 Ga0123355_10000302 3300009826 Bacteria 63226
81 Ga0123355_10001116 3300009826 Bacteria 37140
82 Ga0123355_10010571 3300009826 Bacteria 14166
83 Ga0123355_10014676 3300009826 Bacteria 12265
84 Ga0123355_10020668 3300009826 Bacteria 10520
85 Ga0123355_10065749 3300009826 Bacteria 5840
86 Ga0123355_10109295 3300009826 Archaea 4325
87 Ga0123355_10199136 3300009826 Bacteria 2930
88 Ga0123355_10241423 3300009826 Bacteria 2559
89 Ga0123355_10344451 3300009826 Bacteria 1982
90 Ga0123356_10263247 3300010049 Bacteria 1810
91 Ga0415639_048958 3300038395 Bacteria 10391
92 Ga0466735_175042 3300042624 Bacteria 2136
93 Ga0466727_056530 3300042655 Bacteria 18763
94 JGI24695J34938_10000227 3300002450 Bacteria 53237

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02073 Peptidase_M29 Thermophilic metalloprotease (M29) 55 458 1

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.