Protein Family IF12068

Metagenome Isolate
117 Members
47 Samples
99 Scaffolds
221.13 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820420508|2820421529|
Length
261 aa
Sequence
MNDEKEICKMLQAFTRNYNDNSTDAGFQFTFNCDICGDGYKTSFIESDTYKKKKGSRLLGQGIGLAGNLMGGKLRGLTNAVEHGSNILSERFEGHPPEWHKEHEQAFERAQNEAMQHFHRCPGCNNYVCDHCRNEDAGLCTGCAPRQEVYVAQAHAAAMRRNIDDAGQNANVWQGNIEQKTTICPSCGKPAGTGKFCNNCGASMDLRECPNCGAKNALAVRFCNNCGTNLEQAAVPSGKCGACGFDNPPGTKFCGGCGNKL

📊 Sample Types

Isolate 15.4%
Metagenome 84.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 42.6%
Termitidae 36.2%
Kalotermitidae 6.4%
Passalidae 6.4%
Rhinotermitidae 4.3%
Hodotermitidae 2.1%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 19
Bacteria 69
Eukaryota 0
Viruses 1
Unclassified 28

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
2 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
3 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
13 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
14 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
15 2608642196 Candidatus Methanoplasma termitum MpT1 Isolate Unclassified
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
22 2772190991 Unclassified Bathyarchaeota Emb289P3bin109 Isolate Unclassified
23 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
27 2773857689 Unclassified Methanomassiliicoccaceae Nt197P3bin8 Isolate Unclassified
28 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
33 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
34 2773857684 Unclassified Methanomassiliicoccaceae Lab288P3bin64 Isolate Unclassified
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
41 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
42 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
43 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
44 2773857686 Unclassified Methanomassiliicoccaceae Lab288P4bin70 Isolate Unclassified
45 2773857691 Unclassified Methanomassiliicoccaceae Nt197P4bin4 Isolate Unclassified
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_102993 3300038395 Archaea 2908
2 Ga0123357_10103136 3300009784 Bacteria 3670
3 Ga0123356_10031881 3300010049 Bacteria 4932
4 Ga0123354_10476166 3300010882 Unclassified 991
5 Ga0466729_161217 3300042621 Bacteria 2721
6 JGI24702J35022_10048154 3300002462 Archaea 2269
7 Ga0466706_065272 3300042599 Bacteria 10151
8 Ga0466706_119025 3300042599 Bacteria 9671
9 Ga0123357_10040476 3300009784 Archaea 6336
10 Ga0123357_10259717 3300009784 Bacteria 1839
11 Ga0123356_10037134 3300010049 Bacteria 4546
12 Ga0123356_10371397 3300010049 Unclassified 1560
13 Ga0123353_10003266 3300010167 Unclassified 20466
14 Ga0123353_10076859 3300010167 Unclassified 5365
15 Ga0123353_10169213 3300010167 Bacteria 3470
16 Ga0123353_10177839 3300010167 Bacteria 3371
17 Ga0123353_10488827 3300010167 Unclassified 1798
18 Ga0123353_10517634 3300010167 Unclassified 1732
19 Ga0123353_10587528 3300010167 Unclassified 1596
20 Ga0466726_109480 3300042619 Bacteria 33428
21 2227447465 2225789004 Unclassified 5449
22 JGI24696J40584_12957596 3300002834 Archaea 3598
23 Ga0466706_052593 3300042599 Bacteria 32390
24 Ga0466706_107283 3300042599 Bacteria 14081
25 Ga0466706_275184 3300042599 Bacteria 8048
26 Ga0466707_037420 3300042601 Bacteria 20632
27 Ga0123357_10236861 3300009784 Unclassified 1986
28 Ga0123356_10856975 3300010049 Archaea 1080
29 Ga0123353_10005731 3300010167 Unclassified 16384
30 Ga0123353_10199828 3300010167 Bacteria 3146
31 Ga0123354_10109102 3300010882 Bacteria 3671
32 Ga0123354_10177294 3300010882 Bacteria 2449
33 2227063679 2225789003 Unclassified 18722
34 JGI24702J35022_10069789 3300002462 Unclassified 1891
35 Ga0466707_076466 3300042601 Bacteria 1508
36 Ga0466714_076749 3300042603 Bacteria 4881
37 Ga0466702_181703 3300042635 Bacteria 14519
38 Ga0466697_250752 3300042611 Bacteria 9551
39 Ga0466657_080110 3300042582 Archaea 1181
40 Ga0123357_10016553 3300009784 Bacteria 9712
41 Ga0123356_10027827 3300010049 Bacteria 5297
42 Ga0123353_10004051 3300010167 Bacteria 18779
43 Ga0123354_10001185 3300010882 Bacteria 30683
44 Ga0466707_223942 3300042601 Archaea 1019
45 Ga0466717_211689 3300042604 Unclassified 1356
46 Ga0123353_10200865 3300010167 Bacteria 3136
47 Ga0123354_10036765 3300010882 Bacteria 7633
48 Ga0123354_10068122 3300010882 Viruses 5178
49 IMNBL1DRAFT_c0007583 3300000062 Unclassified 5677
50 JGI24705J35276_12228756 3300002504 Bacteria 3252
51 Ga0466706_031172 3300042599 Unclassified 9519
52 Ga0466706_240214 3300042599 Unclassified 7187
53 Ga0466707_056682 3300042601 Bacteria 1101
54 Ga0466713_050730 3300042602 Bacteria 26316
55 Ga0466713_094611 3300042602 Bacteria 1828
56 Ga0466720_101336 3300042607 Unclassified 1064
57 Ga0466722_041962 3300042609 Bacteria 8016
58 Ga0466734_103321 3300042623 Archaea 1566
59 Ga0123357_10007201 3300009784 Bacteria 13704
60 Ga0123357_10133842 3300009784 Bacteria 3074
61 Ga0123356_10000533 3300010049 Bacteria 42362
62 Ga0123356_10061587 3300010049 Unclassified 3505
63 Ga0123356_10109453 3300010049 Bacteria 2666
64 Ga0123353_10014637 3300010167 Bacteria 11323
65 Ga0123353_10027112 3300010167 Unclassified 8773
66 Ga0123353_10799541 3300010167 Archaea 1302
67 Ga0123353_10939671 3300010167 Unclassified 1171
68 Ga0123354_10338214 3300010882 Unclassified 1361
69 Ga0466706_055642 3300042599 Unclassified 10651
70 Ga0466713_129414 3300042602 Bacteria 16377
71 Ga0466704_420268 3300042643 Bacteria 7547
72 Ga0466725_206242 3300042654 Unclassified 1657
73 Ga0466656_166197 3300042550 Bacteria 1298
74 Ga0466656_384394 3300042550 Bacteria 1830
75 Ga0466657_028118 3300042582 Archaea 1557
76 Ga0123356_10021894 3300010049 Unclassified 6036
77 Ga0123353_10212454 3300010167 Bacteria 3033
78 Ga0123353_10320153 3300010167 Bacteria 2354
79 Ga0123353_10320662 3300010167 Bacteria 2352
80 Ga0123353_10464848 3300010167 Archaea 1857
81 Ga0466711_247712 3300042615 Bacteria 10201
82 Ga0466715_064131 3300042616 Bacteria 3464
83 Ga0466715_427549 3300042616 Unclassified 1485
84 Ga0466726_420388 3300042619 Bacteria 12279
85 IMNBL1DRAFT_c0000001 3300000062 Archaea 477011
86 Ga0466706_154889 3300042599 Bacteria 5208
87 Ga0466706_227512 3300042599 Bacteria 14067
88 Ga0466720_173219 3300042607 Unclassified 4825
89 Ga0466657_115546 3300042582 Bacteria 13928
90 Ga0123357_10003792 3300009784 Bacteria 17486
91 Ga0123356_10006222 3300010049 Bacteria 12065
92 Ga0123356_10054445 3300010049 Bacteria 3726
93 Ga0123353_10100295 3300010167 Unclassified 4666
94 Ga0123353_10341214 3300010167 Unclassified 2262
95 Ga0123353_10846667 3300010167 Archaea 1254
96 Ga0123353_11109184 3300010167 Bacteria 1049
97 Ga0123354_10065524 3300010882 Bacteria 5315
98 IMNBL1DRAFT_c0001387 3300000062 Bacteria 18211
99 Ga0466734_005968 3300042623 Bacteria 27966

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10004051 Ga0123353_1000405113 209
2 3300010167 Ga0123353_10464848 Ga0123353_104648482 209
3 3300010167 Ga0123353_10488827 Ga0123353_104888271 209
4 3300010167 Ga0123353_10587528 Ga0123353_105875281 209
5 3300010882 Ga0123354_10068122 Ga0123354_100681222 209
6 3300010882 Ga0123354_10177294 Ga0123354_101772942 209
7 3300042599 Ga0466706_031172 Ga0466706_031172_6389_7159 209
8 3300042602 Ga0466713_094611 Ga0466713_094611_581_1354 209
9 2225789003 2227063679 2227419310 210
10 3300009784 Ga0123357_10003792 Ga0123357_100037922 210
11 3300009784 Ga0123357_10259717 Ga0123357_102597171 210
12 3300010167 Ga0123353_10177839 Ga0123353_101778392 210
13 3300010167 Ga0123353_11109184 Ga0123353_111091842 210
14 3300010882 Ga0123354_10001185 Ga0123354_1000118524 210
15 3300042582 Ga0466657_080110 Ga0466657_080110_65_826 210
16 3300042643 Ga0466704_420268 Ga0466704_420268_3141_3905 210
17 2225789004 2227447465 2227884947 211
18 3300000062 IMNBL1DRAFT_c0007583 IMNBL1DRAFT_00075833 211
19 3300002462 JGI24702J35022_10069789 JGI24702J35022_100697892 211
20 3300002504 JGI24705J35276_12228756 JGI24705J35276_122287563 211
21 3300010049 Ga0123356_10000533 Ga0123356_100005337 211
22 3300010049 Ga0123356_10037134 Ga0123356_100371345 211
23 3300010167 Ga0123353_10341214 Ga0123353_103412143 211
24 3300042550 Ga0466656_384394 Ga0466656_384394_15_770 211
25 3300042601 Ga0466707_223942 Ga0466707_223942_125_898 211
26 3300010049 Ga0123356_10006222 Ga0123356_100062229 212
27 3300010049 Ga0123356_10856975 Ga0123356_108569752 212
28 3300010882 Ga0123354_10065524 Ga0123354_100655241 212
29 3300010882 Ga0123354_10338214 Ga0123354_103382141 212
30 3300042599 Ga0466706_065272 Ga0466706_065272_2745_3497 212
31 3300042599 Ga0466706_240214 Ga0466706_240214_1909_2664 212
32 3300042615 Ga0466711_247712 Ga0466711_247712_1700_2458 212
33 3300009784 Ga0123357_10007201 Ga0123357_100072013 213
34 3300010049 Ga0123356_10109453 Ga0123356_101094533 213
35 3300010167 Ga0123353_10169213 Ga0123353_101692134 213
36 3300010167 Ga0123353_10320153 Ga0123353_103201532 213
37 3300010167 Ga0123353_10799541 Ga0123353_107995412 213
38 3300010167 Ga0123353_10846667 Ga0123353_108466672 213
39 3300010882 Ga0123354_10109102 Ga0123354_101091024 213
40 3300042599 Ga0466706_055642 Ga0466706_055642_4097_4864 213
41 3300042599 Ga0466706_119025 Ga0466706_119025_1175_1942 213
42 3300042601 Ga0466707_037420 Ga0466707_037420_1694_2452 213
43 3300042607 Ga0466720_101336 Ga0466720_101336_236_1003 213
44 3300042619 Ga0466726_109480 Ga0466726_109480_27368_28129 213
45 3300042623 Ga0466734_103321 Ga0466734_103321_345_1109 213
46 3300002834 JGI24696J40584_12957596 JGI24696J40584_129575966 214
47 3300009784 Ga0123357_10133842 Ga0123357_101338422 214
48 3300010049 Ga0123356_10054445 Ga0123356_100544453 214
49 3300010049 Ga0123356_10371397 Ga0123356_103713971 214
50 3300042599 Ga0466706_275184 Ga0466706_275184_3462_4223 214
51 3300042601 Ga0466707_076466 Ga0466707_076466_560_1342 214
52 3300000062 IMNBL1DRAFT_c0001387 IMNBL1DRAFT_00013875 215
53 3300010167 Ga0123353_10100295 Ga0123353_101002955 215
54 3300010167 Ga0123353_10200865 Ga0123353_102008654 215
55 3300042599 Ga0466706_052593 Ga0466706_052593_8011_8778 215
56 3300042599 Ga0466706_107283 Ga0466706_107283_11658_12419 215
57 3300042604 Ga0466717_211689 Ga0466717_211689_231_998 215
58 3300042623 Ga0466734_005968 Ga0466734_005968_2638_3411 215
59 3300009784 Ga0123357_10236861 Ga0123357_102368611 216
60 3300010049 Ga0123356_10021894 Ga0123356_100218942 216
61 3300010167 Ga0123353_10014637 Ga0123353_100146379 216
62 3300010167 Ga0123353_10027112 Ga0123353_100271122 216
63 3300038395 Ga0415639_102993 Ga0415639_102993_1060_1830 216
64 3300042599 Ga0466706_227512 Ga0466706_227512_8838_9605 216
65 3300042602 Ga0466713_129414 Ga0466713_129414_13849_14628 216
66 3300042619 Ga0466726_420388 Ga0466726_420388_1553_2320 216
67 3300010049 Ga0123356_10061587 Ga0123356_100615872 217
68 3300010167 Ga0123353_10003266 Ga0123353_100032665 217
69 3300010167 Ga0123353_10005731 Ga0123353_100057317 217
70 3300010167 Ga0123353_10320662 Ga0123353_103206622 217
71 3300010167 Ga0123353_10939671 Ga0123353_109396711 217
72 3300010882 Ga0123354_10036765 Ga0123354_1003676510 217
73 3300042582 Ga0466657_115546 Ga0466657_115546_8550_9320 217
74 3300010049 Ga0123356_10027827 Ga0123356_100278275 218
75 3300010167 Ga0123353_10199828 Ga0123353_101998283 218
76 3300042599 Ga0466706_154889 Ga0466706_154889_3805_4563 218
77 3300042601 Ga0466707_056682 Ga0466707_056682_156_920 218
78 3300042603 Ga0466714_076749 Ga0466714_076749_978_1736 218
79 3300042609 Ga0466722_041962 Ga0466722_041962_5630_6415 218
80 3300000062 IMNBL1DRAFT_c0000001 IMNBL1DRAFT_0000001232 219
81 3300002462 JGI24702J35022_10048154 JGI24702J35022_100481542 219
82 3300009784 Ga0123357_10040476 Ga0123357_100404762 219
83 3300009784 Ga0123357_10103136 Ga0123357_101031362 219
84 3300010167 Ga0123353_10517634 Ga0123353_105176342 219
85 3300042616 Ga0466715_427549 Ga0466715_427549_192_986 219
86 3300009784 Ga0123357_10016553 Ga0123357_100165539 220
87 3300010167 Ga0123353_10212454 Ga0123353_102124544 220
88 3300042550 Ga0466656_166197 Ga0466656_166197_483_1256 220
89 3300042602 Ga0466713_050730 Ga0466713_050730_7293_8072 220
90 3300042611 Ga0466697_250752 Ga0466697_250752_3328_4098 220
91 3300010049 Ga0123356_10031881 Ga0123356_100318814 221
92 3300010167 Ga0123353_10076859 Ga0123353_100768595 221
93 3300010882 Ga0123354_10476166 Ga0123354_104761662 221
94 3300042621 Ga0466729_161217 Ga0466729_161217_59_859 226
95 3300042607 Ga0466720_173219 Ga0466720_173219_3515_4504 231
96 iso_pr_bacteria 2820917597 2820918700 232
97 3300042616 Ga0466715_064131 Ga0466715_064131_2495_3331 234
98 3300042582 Ga0466657_028118 Ga0466657_028118_606_1430 235
99 3300042654 Ga0466725_206242 Ga0466725_206242_592_1407 239
100 3300042635 Ga0466702_181703 Ga0466702_181703_3608_4453 241
101 iso_pu_archaea 2773857686 2774159721 245
102 iso_pr_bacteria 2820856540 2820856872 250
103 iso_pr_bacteria 2820356982 2820357508 251
104 iso_pr_bacteria 2820921285 2820922008 251
105 iso_pr_bacteria 2820814774 2820815808 253
106 iso_pr_bacteria 2820854745 2820855675 253
107 iso_pr_bacteria 2820866620 2820867255 253
108 iso_pu_archaea 2608642196 2609088742 253
109 iso_pu_archaea 2773857684 2774157384 253
110 iso_pu_archaea 2773857691 2774165652 253
111 iso_pr_bacteria 2820350530 2820351710 254
112 iso_pu_archaea 2772190991 2773781835 254
113 iso_pr_bacteria 2820867525 2820868940 255
114 iso_pr_bacteria 2820914081 2820914702 255
115 iso_pu_archaea 2773857689 2774163216 257
116 iso_pr_bacteria 2820922474 2820923417 258
117 iso_pr_bacteria 2820420508 2820421529 261

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12773 DZR Double zinc ribbon 184 227 0.96
PF13240 zinc_ribbon_2 zinc-ribbon domain 209 230 0.96
PF24463 207 231 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.5 0.66 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.