Protein Family IF12055
Metagenome
Isolate
123
Members
69
Samples
98
Scaffolds
308.16
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820367663|2820369096|
- Length
- 361 aa
- Sequence
- LETVFLPPQKTQVRADEDALIIFHKNGTCLDIRICGRIVKHHYDWRIIHRVGKRGERLVRFIVKRVFSAVVTLFVVATLTFFLMNIVPGGPFNTERASKKTVEAMERKYGLDKPLLEQYTMYMGRLLRFDLGDSYKRIGFSVNQIIGEKFPVSAGLGVVAICFALLMGVPAGVYAAYKRNSVVDRIIMFIATLGIAVPNFVMATTLLLLFGVALGWLPTLGLSSWQHYIMPAIALSFFPSCFIARLTRSSMLDVLGQDYIKTARAKGLAERKVIFKHALRISIVPVVSYLAILSAGVLTGGFVIERIFTVPGMGKFFIESINNRDYPLVMGTTVFFSAVLIFLNLIVDLLYGVIDPRIQYD
Sample Types
Isolate
20.3%
Metagenome
79.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.5%
Termitidae
20.6%
Kalotermitidae
20.6%
Elmidae
7.4%
Rhinotermitidae
2.9%
Tenebrionidae
2.9%
Passalidae
2.9%
Culicidae
2.9%
Termopsidae
2.9%
Hodotermitidae
1.5%
Armadillidiidae
1.5%
Drosophilidae
1.5%
Nephropidae
1.5%
Scarabaeidae
1.5%
Hydrophilidae
1.5%
Curculionidae
1.5%
Taxonomy
Archaea
0
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 2 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 12 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 13 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 23 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 24 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 25 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 26 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 32 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 33 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 40 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 41 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 44 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 45 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 48 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 49 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 50 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 51 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 52 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 53 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 59 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 60 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 61 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 64 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 65 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_0755 | 3300056856 | Bacteria | 56835 |
| 2 | Ga0123353_10696316 | 3300010167 | Bacteria | 1427 |
| 3 | Ga0123353_10727523 | 3300010167 | Bacteria | 1386 |
| 4 | Ga0123354_10079535 | 3300010882 | Unclassified | 4650 |
| 5 | Ga0160460_100870 | 3300012845 | Bacteria | 13142 |
| 6 | Ga0466701_025087 | 3300042598 | Unclassified | 1735 |
| 7 | Ga0466706_239472 | 3300042599 | Bacteria | 3366 |
| 8 | Ga0466714_079803 | 3300042603 | Bacteria | 3638 |
| 9 | Ga0466716_285740 | 3300042605 | Bacteria | 1667 |
| 10 | Ga0466698_217941 | 3300042610 | Bacteria | 1256 |
| 11 | Ga0466729_085138 | 3300042621 | Bacteria | 9837 |
| 12 | Ga0466702_314545 | 3300042635 | Bacteria | 6000 |
| 13 | Ga0466702_424962 | 3300042635 | Bacteria | 1730 |
| 14 | Ga0466708_062047 | 3300042652 | Bacteria | 3742 |
| 15 | Ga0068305_10001831 | 3300005083 | Bacteria | 35448 |
| 16 | Ga0466705_006239 | 3300042612 | Bacteria | 4932 |
| 17 | Ga0123356_10133485 | 3300010049 | Bacteria | 2436 |
| 18 | Ga0123356_10139611 | 3300010049 | Bacteria | 2389 |
| 19 | Ga0123353_10111999 | 3300010167 | Bacteria | 4395 |
| 20 | Ga0123353_10161178 | 3300010167 | Unclassified | 3571 |
| 21 | Ga0160435_1009284 | 3300012857 | Bacteria | 2092 |
| 22 | Ga0466693_207170 | 3300042592 | Bacteria | 2655 |
| 23 | Ga0466714_071064 | 3300042603 | Bacteria | 5079 |
| 24 | Ga0466714_142028 | 3300042603 | Unclassified | 3479 |
| 25 | Ga0466711_030518 | 3300042615 | Bacteria | 21293 |
| 26 | Ga0466723_004459 | 3300042618 | Bacteria | 4206 |
| 27 | Ga0466726_103660 | 3300042619 | Bacteria | 15823 |
| 28 | Ga0466702_013585 | 3300042635 | Unclassified | 1556 |
| 29 | Ga0466702_177604 | 3300042635 | Bacteria | 1094 |
| 30 | 2227544088 | 2225789004 | Bacteria | 15330 |
| 31 | Ga0562375_0703 | 3300056856 | Bacteria | 59901 |
| 32 | Ga0123353_10029624 | 3300010167 | Unclassified | 8441 |
| 33 | Ga0160464_100967 | 3300012805 | Bacteria | 13955 |
| 34 | Ga0466690_018132 | 3300042590 | Bacteria | 1404 |
| 35 | Ga0466716_408413 | 3300042605 | Bacteria | 4297 |
| 36 | Ga0466704_350863 | 3300042643 | Bacteria | 2137 |
| 37 | IMNBL1DRAFT_c0001917 | 3300000062 | Unclassified | 15062 |
| 38 | Ga0123357_10021611 | 3300009784 | Unclassified | 8613 |
| 39 | Ga0123356_10289396 | 3300010049 | Bacteria | 1738 |
| 40 | Ga0123353_10126415 | 3300010167 | Bacteria | 4109 |
| 41 | Ga0123353_10144158 | 3300010167 | Bacteria | 3811 |
| 42 | Ga0466696_007242 | 3300042596 | Bacteria | 5198 |
| 43 | Ga0466696_042464 | 3300042596 | Unclassified | 4977 |
| 44 | Ga0466707_011223 | 3300042601 | Bacteria | 1995 |
| 45 | Ga0466714_012599 | 3300042603 | Bacteria | 1570 |
| 46 | Ga0466714_117220 | 3300042603 | Bacteria | 13666 |
| 47 | Ga0466719_251327 | 3300042606 | Bacteria | 28934 |
| 48 | Ga0466723_017882 | 3300042618 | Bacteria | 24080 |
| 49 | Ga0466723_212999 | 3300042618 | Bacteria | 9859 |
| 50 | Ga0466726_427681 | 3300042619 | Bacteria | 5211 |
| 51 | Ga0466705_030692 | 3300042612 | Bacteria | 4343 |
| 52 | Ga0123356_10183957 | 3300010049 | Bacteria | 2114 |
| 53 | Ga0123353_10548836 | 3300010167 | Bacteria | 1667 |
| 54 | Ga0160445_100826 | 3300012847 | Bacteria | 11414 |
| 55 | Ga0466715_557156 | 3300042616 | Bacteria | 49402 |
| 56 | Ga0466702_264967 | 3300042635 | Bacteria | 2250 |
| 57 | Ga0466703_142143 | 3300042636 | Bacteria | 9591 |
| 58 | Ga0466709_053153 | 3300042648 | Bacteria | 6204 |
| 59 | Ga0466708_407779 | 3300042652 | Bacteria | 1259 |
| 60 | 2212578247 | 2209111004 | Bacteria | 5765 |
| 61 | IMNBL1DRAFT_c0003349 | 3300000062 | Bacteria | 10393 |
| 62 | IMNBL1DRAFT_c0009414 | 3300000062 | Bacteria | 4820 |
| 63 | Ga0562379_0688 | 3300056790 | Bacteria | 57424 |
| 64 | Ga0123356_10017716 | 3300010049 | Bacteria | 6769 |
| 65 | Ga0123353_10090015 | 3300010167 | Bacteria | 4942 |
| 66 | Ga0123353_10113731 | 3300010167 | Bacteria | 4357 |
| 67 | Ga0123353_10145246 | 3300010167 | Bacteria | 3794 |
| 68 | Ga0415639_081964 | 3300038395 | Bacteria | 1222 |
| 69 | Ga0466691_095675 | 3300042593 | Bacteria | 20573 |
| 70 | Ga0466706_081404 | 3300042599 | Bacteria | 6550 |
| 71 | Ga0466714_002497 | 3300042603 | Bacteria | 9597 |
| 72 | Ga0466714_084501 | 3300042603 | Bacteria | 49226 |
| 73 | Ga0466729_285048 | 3300042621 | Unclassified | 8901 |
| 74 | 2227210248 | 2225789004 | Bacteria | 1415 |
| 75 | Ga0123356_10725390 | 3300010049 | Bacteria | 1163 |
| 76 | Ga0123353_10031856 | 3300010167 | Bacteria | 8177 |
| 77 | Ga0123353_10285396 | 3300010167 | Bacteria | 2532 |
| 78 | Ga0123353_10326678 | 3300010167 | Bacteria | 2325 |
| 79 | Ga0123353_10362233 | 3300010167 | Bacteria | 2178 |
| 80 | Ga0123353_10553448 | 3300010167 | Bacteria | 1658 |
| 81 | Ga0123354_10298459 | 3300010882 | Unclassified | 1529 |
| 82 | Ga0466690_111460 | 3300042590 | Unclassified | 5461 |
| 83 | Ga0466705_480106 | 3300042612 | Bacteria | 5184 |
| 84 | Ga0466715_611280 | 3300042616 | Bacteria | 33924 |
| 85 | Ga0466728_027377 | 3300042620 | Bacteria | 6682 |
| 86 | Ga0466724_02890 | 3300042649 | Bacteria | 169295 |
| 87 | Ga0123353_10001974 | 3300010167 | Bacteria | 25318 |
| 88 | Ga0123353_10529437 | 3300010167 | Bacteria | 1707 |
| 89 | Ga0466656_266437 | 3300042550 | Bacteria | 2524 |
| 90 | Ga0466701_100112 | 3300042598 | Bacteria | 4211 |
| 91 | Ga0466713_086439 | 3300042602 | Unclassified | 51900 |
| 92 | Ga0466722_188855 | 3300042609 | Bacteria | 43444 |
| 93 | Ga0466711_030511 | 3300042615 | Bacteria | 2884 |
| 94 | Ga0466715_171195 | 3300042616 | Bacteria | 14962 |
| 95 | Ga0466729_317599 | 3300042621 | Bacteria | 13539 |
| 96 | Ga0466731_417024 | 3300042622 | Bacteria | 6271 |
| 97 | Ga0466708_073357 | 3300042652 | Bacteria | 7995 |
| 98 | Ga0466727_288370 | 3300042655 | Bacteria | 1206 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.