Protein Family IF12027

Metagenome Metatranscriptome Isolate
151 Members
67 Samples
119 Scaffolds
116.42 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820277137|2820279003|
Length
123 aa
Sequence
MARIKGGQNAKKKHKRVLKLAKGYRGARSKQYRVAKQSVMRALATSYSGRKERKRQFRRLWIARINAACRLNGLSYNKFMFGLKQAEVDINRKMLAELAINDAEGFASLVEIAKAQIDPAKIA

📊 Sample Types

Isolate 21.2%
Metagenome 78.2%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.0%
Termitidae 34.8%
Kalotermitidae 7.6%
Stratiomyidae 3.0%
Passalidae 3.0%
Scarabaeidae 1.5%
Hodotermitidae 1.5%
Rhinotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
2 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
3 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
4 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
12 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
13 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
24 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
34 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
35 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
36 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
45 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
46 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
47 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
51 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
52 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
53 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
54 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
55 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
56 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
57 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
58 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
59 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
60 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
61 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
62 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
63 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
64 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
65 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
66 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
67 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_271916 3300042599 Bacteria 6801
2 Ga0466700_100485 3300042600 Bacteria 1113
3 Ga0466714_014071 3300042603 Bacteria 9900
4 Ga0466717_149918 3300042604 Unclassified 11328
5 Ga0466721_061909 3300042608 Bacteria 1178
6 Ga0415639_043804 3300038395 Bacteria 7364
7 Ga0415639_047775 3300038395 Bacteria 3807
8 Ga0123355_10001611 3300009826 Bacteria 31520
9 Ga0123355_10060253 3300009826 Bacteria 6129
10 Ga0123355_10089353 3300009826 Bacteria 4890
11 Ga0123355_10579201 3300009826 Bacteria 1342
12 Ga0123353_10105215 3300010167 Bacteria 4548
13 Ga0123353_10770402 3300010167 Bacteria 1335
14 JGI24702J35022_10027208 3300002462 Unclassified 3076
15 JGI24705J35276_12234141 3300002504 Unclassified 5289
16 Ga0466733_026323 3300042659 Bacteria 1197
17 Ga0466706_152332 3300042599 Bacteria 5777
18 Ga0466707_159669 3300042601 Bacteria 505639
19 Ga0466715_379405 3300042616 Bacteria 14578
20 Ga0415639_199314 3300038395 Bacteria 994
21 Ga0123355_10016806 3300009826 Bacteria 11542
22 Ga0123355_10057281 3300009826 Bacteria 6306
23 Ga0123355_10182966 3300009826 Bacteria 3106
24 Ga0123353_13221057 3300010167 Unclassified 523
25 2227503277 2225789004 Bacteria 732
26 JGI24700J35501_10129843 3300002508 Bacteria 503
27 Ga0466706_234365 3300042599 Bacteria 2408
28 Ga0466713_060178 3300042602 Bacteria 10348
29 Ga0466702_465817 3300042635 Bacteria 1324
30 Ga0466724_27257 3300042649 Bacteria 2636
31 Ga0466710_292648 3300042613 Bacteria 1409
32 Ga0466715_490862 3300042616 Bacteria 1914
33 Ga0123357_10693948 3300009784 Bacteria 733
34 Ga0123357_11021589 3300009784 Bacteria 511
35 Ga0123355_10040539 3300009826 Bacteria 7580
36 Ga0123355_10264400 3300009826 Unclassified 2401
37 Ga0123355_10306290 3300009826 Bacteria 2159
38 Ga0123355_10543272 3300009826 Bacteria 1409
39 Ga0123355_10886441 3300009826 Unclassified 973
40 Ga0123355_11762712 3300009826 Bacteria 586
41 Ga0123356_10498405 3300010049 Bacteria 1373
42 Ga0123356_12603574 3300010049 Bacteria 633
43 Ga0123356_13974374 3300010049 Bacteria 509
44 Ga0123353_10098510 3300010167 Bacteria 4711
45 Ga0123353_10310181 3300010167 Bacteria 2402
46 Ga0123353_11247911 3300010167 Bacteria 970
47 Ga0123353_11923115 3300010167 Bacteria 729
48 IMNBL1DRAFT_c0001801 3300000062 Bacteria 15621
49 JGI24700J35501_10146905 3300002508 Bacteria 512
50 JGI24700J35501_10930884 3300002508 Bacteria 33905
51 Ga0466705_002773 3300042612 Bacteria 52043
52 Ga0466733_128256 3300042659 Bacteria 2673
53 Ga0466700_158992 3300042600 Bacteria 1055
54 Ga0466716_523224 3300042605 Bacteria 2822
55 Ga0466702_254250 3300042635 Bacteria 7697
56 Ga0466725_140678 3300042654 Bacteria 5809
57 Ga0466695_083915 3300042595 Bacteria 2376
58 Ga0123357_10753680 3300009784 Bacteria 676
59 Ga0123355_10026006 3300009826 Bacteria 9434
60 Ga0123355_10206743 3300009826 Bacteria 2855
61 Ga0123355_10240706 3300009826 Unclassified 2564
62 Ga0123355_10410086 3300009826 Bacteria 1740
63 Ga0123353_11207462 3300010167 Bacteria 992
64 Ga0123354_10117253 3300010882 Bacteria 3467
65 JGI24700J35501_10929144 3300002508 Unclassified 8692
66 Ga0466733_058164 3300042659 Bacteria 1834
67 Ga0466722_200852 3300042609 Bacteria 7274
68 Ga0466704_072183 3300042643 Bacteria 2094
69 Ga0466711_100504 3300042615 Bacteria 14383
70 Ga0123355_10064497 3300009826 Bacteria 5903
71 Ga0123355_10133654 3300009826 Bacteria 3816
72 Ga0123355_10305318 3300009826 Bacteria 2164
73 Ga0123355_10700524 3300009826 Bacteria 1163
74 Ga0123355_11706738 3300009826 Bacteria 600
75 Ga0123353_10019965 3300010167 Bacteria 9985
76 Ga0123353_10456800 3300010167 Bacteria 1878
77 Ga0123353_10515531 3300010167 Bacteria 1737
78 Ga0123353_10611718 3300010167 Bacteria 1554
79 Ga0123353_10661392 3300010167 Bacteria 1476
80 Ga0123353_10794769 3300010167 Unclassified 1308
81 Ga0123353_12321961 3300010167 Bacteria 644
82 IMNBL1DRAFT_c0001581 3300000062 Bacteria 16940
83 Ga0072941_1148285 3300005201 Bacteria 13133
84 Ga0466731_421037 3300042622 Bacteria 1552
85 Ga0466704_148158 3300042643 Unclassified 1716
86 Ga0466725_408088 3300042654 Unclassified 2693
87 Ga0223688_1004964 3300021227 Bacteria 574
88 Ga0415639_177910 3300038395 Bacteria 1687
89 Ga0123355_10002050 3300009826 Bacteria 28456
90 Ga0123355_10045617 3300009826 Bacteria 7129
91 Ga0123355_10373720 3300009826 Unclassified 1864
92 Ga0123355_10456888 3300009826 Bacteria 1606
93 Ga0123355_10673591 3300009826 Bacteria 1198
94 Ga0123355_10959262 3300009826 Bacteria 916
95 Ga0123355_11264475 3300009826 Bacteria 745
96 Ga0123356_11050358 3300010049 Bacteria 984
97 Ga0123354_10165349 3300010882 Unclassified 2603
98 Ga0466711_226691 3300042615 Bacteria 2792
99 Ga0466699_261484 3300042597 Bacteria 4692
100 Ga0123355_10530270 3300009826 Bacteria 1435
101 Ga0123355_11060927 3300009826 Unclassified 850
102 Ga0123355_11154147 3300009826 Bacteria 798
103 Ga0123356_12168632 3300010049 Bacteria 694
104 Ga0123353_10266409 3300010167 Unclassified 2643
105 Ga0123353_10536621 3300010167 Bacteria 1692
106 Ga0123353_10937050 3300010167 Bacteria 1173
107 2227358563 2225789004 Bacteria 106790
108 IMNBL1DRAFT_c0008855 3300000062 Bacteria 5067
109 Ga0466706_030307 3300042599 Bacteria 2733
110 Ga0466700_478085 3300042600 Bacteria 1796
111 Ga0466714_057312 3300042603 Bacteria 1335
112 Ga0466718_057309 3300042617 Bacteria 1784
113 Ga0123355_10011767 3300009826 Bacteria 13514
114 Ga0123355_10058805 3300009826 Bacteria 6217
115 Ga0123355_11050292 3300009826 Unclassified 856
116 Ga0123355_11346698 3300009826 Unclassified 711
117 Ga0123355_11612907 3300009826 Bacteria 624
118 JGI24700J35501_10900499 3300002508 Bacteria 3012
119 Ga0072941_1061028 3300005201 Bacteria 21779

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00453 Ribosomal_L20 Ribosomal protein L20 3 109 0.99

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.