Protein Family IF11998

Metagenome Isolate
141 Members
62 Samples
103 Scaffolds
511.17 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820246658|2820247488|
Length
560 aa
Sequence
MLFTSSAFLLFLAVLLALYSLTPQKYRWLVLLAGSMAFYGLAEPLFLLYICSTIAITYICTMLISGAWLRRDKKLLEMMSNVGDLANADDRSGGTRRAGITSYRDAPADGDKELRRQVRGTAKAVCKRWMLLCLFLILGILSVVKYTDFTVSNVNSMLSFFGSSKRFGIFGIIVPMGISFYTFQAVGYVVDVYREKAKIERNPLKLALFISFFPQVVQGPISRFGELSKTLYSGDPLTRSGAARGAHRILWGFFKKLVIADRLWPALSFLTANSDSYQGVYYLFTIALYAVVLYCDFSGGIDIAIGVAEMFGVRLPENFNRPFYSKSIQEYWQRWHMTMYGWFRDYVFYPMAASKKMLKFSKACRKPFGNSFAKRLPVHISLVFVWFLTGLWHGAAWNFIVWGLINGFVLMVSLEFAPLYARFNARFPSLSKNLLWRCFQILRTFWLMNLIRSFDIYAGVSNTFKMIGTVTSNFSLDKFIGEGISNLTLPISDYISAGAGLLIVFFVSYLGRGESDYRDRLLKIKWPLRYVAAGLVFFMTLIMGAWGHGFDARQFIYNMF

📊 Sample Types

Isolate 25.5%
Metagenome 74.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 58.1%
Termitidae 29.0%
Kalotermitidae 11.3%
Passalidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
2 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
3 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
4 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
5 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
6 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
7 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
8 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
11 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
12 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
13 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
14 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
17 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
20 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
21 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
32 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
33 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
34 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
35 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
36 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
37 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
38 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
39 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
40 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
43 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
44 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
45 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
48 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
49 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
50 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
51 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
52 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
53 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
54 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
57 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
58 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
59 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
60 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466656_056471 3300042550 Bacteria 3366
2 Ga0123355_10001231 3300009826 Bacteria 35708
3 Ga0123356_10002654 3300010049 Bacteria 19006
4 Ga0123356_10010109 3300010049 Bacteria 9279
5 Ga0123356_10010898 3300010049 Unclassified 8885
6 Ga0123353_10000039 3300010167 Bacteria 140682
7 Ga0123353_10000245 3300010167 Bacteria 68017
8 Ga0466704_531475 3300042643 Bacteria 2563
9 JGI24705J35276_12237899 3300002504 Unclassified 14012
10 Ga0415639_032838 3300038395 Bacteria 4600
11 Ga0466701_083323 3300042598 Bacteria 4134
12 Ga0466700_421762 3300042600 Bacteria 1988
13 Ga0466721_356261 3300042608 Bacteria 36576
14 Ga0123355_10036176 3300009826 Bacteria 8028
15 Ga0123355_10109232 3300009826 Bacteria 4327
16 Ga0123355_10114593 3300009826 Bacteria 4201
17 Ga0123356_10000208 3300010049 Bacteria 68366
18 Ga0123356_10016567 3300010049 Bacteria 7028
19 Ga0123356_10092194 3300010049 Bacteria 2889
20 Ga0123353_10000395 3300010167 Bacteria 53691
21 Ga0123353_10002746 3300010167 Bacteria 21956
22 Ga0123353_10356358 3300010167 Bacteria 2201
23 JGI24703J35330_11748858 3300002501 Bacteria 56968
24 Ga0415639_073012 3300038395 Bacteria 6427
25 Ga0466721_064563 3300042608 Bacteria 36610
26 Ga0123355_10000001 3300009826 Bacteria 286680
27 Ga0123355_10000224 3300009826 Bacteria 71582
28 Ga0123355_10033710 3300009826 Bacteria 8317
29 Ga0123355_10050474 3300009826 Bacteria 6758
30 Ga0123356_10002032 3300010049 Bacteria 21840
31 Ga0123356_10020855 3300010049 Bacteria 6198
32 Ga0123356_10035122 3300010049 Bacteria 4685
33 Ga0123356_10048043 3300010049 Bacteria 3971
34 Ga0123356_10057195 3300010049 Bacteria 3635
35 Ga0466703_172002 3300042636 Bacteria 6639
36 Ga0466708_009247 3300042652 Bacteria 42833
37 Ga0466728_041240 3300042620 Bacteria 6899
38 IMNBL1DRAFT_c0000939 3300000062 Bacteria 22477
39 Ga0466714_021660 3300042603 Bacteria 4543
40 Ga0466721_261357 3300042608 Bacteria 35337
41 Ga0123355_10000031 3300009826 Bacteria 139810
42 Ga0123355_10000255 3300009826 Bacteria 68435
43 Ga0123355_10004906 3300009826 Bacteria 19467
44 Ga0123355_10121311 3300009826 Bacteria 4054
45 Ga0123355_10369739 3300009826 Bacteria 1879
46 Ga0123355_10396513 3300009826 Bacteria 1784
47 Ga0123356_10015093 3300010049 Bacteria 7407
48 JGI24695J34938_10000051 3300002450 Bacteria 90677
49 Ga0415639_134558 3300038395 Bacteria 3565
50 Ga0466691_171342 3300042593 Bacteria 17101
51 Ga0123355_10000686 3300009826 Bacteria 46020
52 Ga0123355_10001195 3300009826 Bacteria 36126
53 Ga0123355_10002544 3300009826 Bacteria 25834
54 Ga0123355_10016342 3300009826 Bacteria 11693
55 Ga0123355_10039040 3300009826 Unclassified 7722
56 Ga0123356_10000050 3300010049 Bacteria 128418
57 Ga0123356_10034422 3300010049 Bacteria 4734
58 Ga0123353_10000642 3300010167 Bacteria 42754
59 Ga0123354_10121393 3300010882 Bacteria 3373
60 Ga0466704_157983 3300042643 Bacteria 18525
61 Ga0466718_023471 3300042617 Bacteria 2744
62 Ga0466723_069175 3300042618 Bacteria 10903
63 JGI24695J34938_10000786 3300002450 Bacteria 29643
64 JGI24695J34938_10001496 3300002450 Bacteria 19726
65 Ga0466717_029100 3300042604 Bacteria 5534
66 Ga0466721_275466 3300042608 Bacteria 134922
67 Ga0123355_10000617 3300009826 Bacteria 48065
68 Ga0123355_10005976 3300009826 Bacteria 17949
69 Ga0123355_10030183 3300009826 Bacteria 8784
70 Ga0123355_10076134 3300009826 Bacteria 5369
71 Ga0123355_10162246 3300009826 Bacteria 3364
72 Ga0123356_10009386 3300010049 Bacteria 9662
73 Ga0123356_10030808 3300010049 Bacteria 5019
74 Ga0123356_10095474 3300010049 Bacteria 2842
75 Ga0123356_10120193 3300010049 Bacteria 2553
76 Ga0123353_10097419 3300010167 Bacteria 4740
77 Ga0123353_10437537 3300010167 Bacteria 1931
78 Ga0466704_241216 3300042643 Bacteria 19663
79 Ga0466711_032344 3300042615 Bacteria 4532
80 JGI24695J34938_10008200 3300002450 Bacteria 5990
81 Ga0415639_002954 3300038395 Bacteria 30724
82 Ga0466694_140449 3300042594 Bacteria 1810
83 Ga0466700_232189 3300042600 Bacteria 6592
84 Ga0466714_111277 3300042603 Bacteria 7177
85 Ga0123355_10000301 3300009826 Bacteria 63243
86 Ga0123355_10002250 3300009826 Bacteria 27247
87 Ga0123356_10016526 3300010049 Bacteria 7037
88 Ga0123356_10023633 3300010049 Unclassified 5783
89 Ga0123356_10175860 3300010049 Bacteria 2157
90 Ga0123353_10037678 3300010167 Bacteria 7587
91 Ga0123353_10433173 3300010167 Bacteria 1943
92 Ga0466710_454989 3300042613 Bacteria 2781
93 JGI24695J34938_10004246 3300002450 Bacteria 9501
94 Ga0466733_217317 3300042659 Bacteria 7844
95 Ga0415639_087522 3300038395 Bacteria 4860
96 Ga0123355_10020895 3300009826 Bacteria 10469
97 Ga0123355_10334684 3300009826 Bacteria 2024
98 Ga0123355_10436874 3300009826 Bacteria 1660
99 Ga0123356_10000024 3300010049 Bacteria 172450
100 Ga0123356_10004529 3300010049 Bacteria 14340
101 Ga0123353_10062509 3300010167 Archaea 5971
102 Ga0123353_10065543 3300010167 Unclassified 5831
103 Ga0123353_10137195 3300010167 Bacteria 3923

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 203 359 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.