Protein Family IF11977
Metagenome
Isolate
118
Members
51
Samples
105
Scaffolds
287.53
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820223845|2820224613|
- Length
- 331 aa
- Sequence
- MLSKTGYQTEGVLGQNVSYGNTDRRIEYTKWQKKKRRTMRGSLRRGWKGIFVKAALVILGVVIMYPLIVTFSNSFMSGNEISYTYTSRLTVFDIVNGIQSKFIQIPVIPGSATVSQYSEVLINQPSFMVLLTNSLKIAVPVVLGNLIVSLLTAFGFTMWKWKYKETVFFIYIVVMLMPLQAVLVPNYIIADRLGLTNSYLAIILPGIFAPFGTFLLRQSLKAMPKEYFEAAQVDGASFRYIFTNIVIPQMKSGIAALSMLVFIEYWNVVEQVVIFIKDYIREPLSVYLSRLSSSNADIIFAASCIYMFLPLWFLLLGQEDLEKGIELSGIK
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.0%
Unclassified
28.0%
Kalotermitidae
18.0%
Rhinotermitidae
6.0%
Termopsidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 8 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 9 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 10 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 11 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 20 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 27 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 28 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 29 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_168990 | 3300042612 | Bacteria | 3912 |
| 2 | Ga0466732_422570 | 3300042656 | Bacteria | 1704 |
| 3 | Ga0466700_103690 | 3300042600 | Bacteria | 1202 |
| 4 | Ga0466700_262554 | 3300042600 | Bacteria | 5040 |
| 5 | JGI24698J34947_10001426 | 3300002449 | Bacteria | 12579 |
| 6 | JGI24698J34947_10026950 | 3300002449 | Bacteria | 3050 |
| 7 | JGI24698J34947_10035482 | 3300002449 | Bacteria | 2602 |
| 8 | JGI24703J35330_11746683 | 3300002501 | Bacteria | 5515 |
| 9 | Ga0072941_1046323 | 3300005201 | Bacteria | 7410 |
| 10 | Ga0466712_045152 | 3300042614 | Bacteria | 8347 |
| 11 | Ga0466712_250248 | 3300042614 | Bacteria | 7486 |
| 12 | Ga0466705_274451 | 3300042612 | Bacteria | 10936 |
| 13 | Ga0466692_147873 | 3300042591 | Bacteria | 8969 |
| 14 | Ga0466716_189688 | 3300042605 | Bacteria | 10249 |
| 15 | Ga0466722_122967 | 3300042609 | Bacteria | 3434 |
| 16 | Ga0466722_167846 | 3300042609 | Bacteria | 5329 |
| 17 | Ga0123355_10276362 | 3300009826 | Bacteria | 2326 |
| 18 | Ga0123356_10016262 | 3300010049 | Bacteria | 7105 |
| 19 | AustNasuHG_c1003980 | 3300000089 | Bacteria | 5323 |
| 20 | JGI24698J34947_10001077 | 3300002449 | Unclassified | 14051 |
| 21 | JGI24698J34947_10004306 | 3300002449 | Bacteria | 7748 |
| 22 | JGI24698J34947_10091094 | 3300002449 | Bacteria | 1399 |
| 23 | Ga0072940_1387136 | 3300005200 | Bacteria | 1530 |
| 24 | Ga0466712_144326 | 3300042614 | Bacteria | 13309 |
| 25 | Ga0466726_288378 | 3300042619 | Bacteria | 3756 |
| 26 | Ga0466700_358321 | 3300042600 | Bacteria | 1591 |
| 27 | Ga0466720_133413 | 3300042607 | Bacteria | 3710 |
| 28 | Ga0466721_334217 | 3300042608 | Bacteria | 4755 |
| 29 | Ga0123356_10030082 | 3300010049 | Bacteria | 5084 |
| 30 | Ga0123353_10089519 | 3300010167 | Bacteria | 4956 |
| 31 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 32 | JGI24695J34938_10000297 | 3300002450 | Bacteria | 49030 |
| 33 | Ga0466731_018961 | 3300042622 | Bacteria | 4178 |
| 34 | Ga0466709_166775 | 3300042648 | Bacteria | 2711 |
| 35 | Ga0466725_233834 | 3300042654 | Bacteria | 2303 |
| 36 | Ga0466712_137959 | 3300042614 | Bacteria | 23695 |
| 37 | Ga0466712_170101 | 3300042614 | Unclassified | 1293 |
| 38 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 39 | Ga0466718_169320 | 3300042617 | Bacteria | 3255 |
| 40 | Ga0466692_158325 | 3300042591 | Bacteria | 4962 |
| 41 | Ga0466699_429337 | 3300042597 | Bacteria | 7244 |
| 42 | Ga0466700_263224 | 3300042600 | Bacteria | 4147 |
| 43 | Ga0466719_434337 | 3300042606 | Bacteria | 18491 |
| 44 | Ga0466721_345686 | 3300042608 | Bacteria | 1437 |
| 45 | Ga0123355_10735641 | 3300009826 | Bacteria | 1120 |
| 46 | Ga0123356_10004171 | 3300010049 | Bacteria | 14989 |
| 47 | Ga0123356_10143546 | 3300010049 | Bacteria | 2358 |
| 48 | Ga0123353_10002600 | 3300010167 | Bacteria | 22464 |
| 49 | Ga0123353_10200720 | 3300010167 | Bacteria | 3138 |
| 50 | JGI24698J34947_10062756 | 3300002449 | Bacteria | 1824 |
| 51 | JGI24695J34938_10003744 | 3300002450 | Bacteria | 10394 |
| 52 | JGI24695J34938_10041789 | 3300002450 | Bacteria | 2057 |
| 53 | Ga0466708_224717 | 3300042652 | Bacteria | 42914 |
| 54 | Ga0466712_066723 | 3300042614 | Bacteria | 8594 |
| 55 | Ga0466728_116894 | 3300042620 | Bacteria | 7521 |
| 56 | Ga0466732_058794 | 3300042656 | Bacteria | 1448 |
| 57 | Ga0456237_0009272 | 3300041968 | Bacteria | 1468 |
| 58 | Ga0466699_056021 | 3300042597 | Bacteria | 1652 |
| 59 | Ga0466707_387069 | 3300042601 | Bacteria | 86246 |
| 60 | Ga0123355_10335346 | 3300009826 | Bacteria | 2021 |
| 61 | Ga0123353_10999700 | 3300010167 | Bacteria | 1124 |
| 62 | JGI24695J34938_10040544 | 3300002450 | Bacteria | 2096 |
| 63 | JGI24705J35276_12238201 | 3300002504 | Bacteria | 17219 |
| 64 | Ga0072940_1212256 | 3300005200 | Bacteria | 1572 |
| 65 | Ga0466731_023924 | 3300042622 | Bacteria | 1060 |
| 66 | Ga0466715_263484 | 3300042616 | Bacteria | 8916 |
| 67 | Ga0466726_463543 | 3300042619 | Bacteria | 6344 |
| 68 | Ga0466657_201994 | 3300042582 | Bacteria | 2077 |
| 69 | Ga0466693_376710 | 3300042592 | Bacteria | 20175 |
| 70 | Ga0466696_311363 | 3300042596 | Bacteria | 6088 |
| 71 | Ga0466717_294810 | 3300042604 | Bacteria | 9955 |
| 72 | Ga0123355_10009148 | 3300009826 | Unclassified | 15029 |
| 73 | Ga0123355_10022535 | 3300009826 | Bacteria | 10096 |
| 74 | Ga0123356_10015282 | 3300010049 | Bacteria | 7360 |
| 75 | Ga0123353_10609283 | 3300010167 | Bacteria | 1558 |
| 76 | IMNBL1DRAFT_c0009221 | 3300000062 | Bacteria | 4899 |
| 77 | JGI24698J34947_10000541 | 3300002449 | Bacteria | 17921 |
| 78 | JGI24698J34947_10051668 | 3300002449 | Bacteria | 2066 |
| 79 | Ga0466731_237224 | 3300042622 | Bacteria | 2741 |
| 80 | Ga0466708_072396 | 3300042652 | Bacteria | 9022 |
| 81 | Ga0466711_403384 | 3300042615 | Bacteria | 3558 |
| 82 | Ga0466726_257491 | 3300042619 | Bacteria | 2044 |
| 83 | Ga0466726_474880 | 3300042619 | Bacteria | 2215 |
| 84 | Ga0466720_094458 | 3300042607 | Bacteria | 5429 |
| 85 | Ga0466722_253725 | 3300042609 | Bacteria | 5463 |
| 86 | Ga0123356_10058220 | 3300010049 | Bacteria | 3602 |
| 87 | Ga0123353_10006834 | 3300010167 | Bacteria | 15309 |
| 88 | Ga0123353_10089420 | 3300010167 | Bacteria | 4959 |
| 89 | Ga0466731_086150 | 3300042622 | Bacteria | 7177 |
| 90 | Ga0466712_086762 | 3300042614 | Bacteria | 4035 |
| 91 | Ga0466712_139813 | 3300042614 | Unclassified | 3369 |
| 92 | Ga0466715_040383 | 3300042616 | Bacteria | 39203 |
| 93 | Ga0466726_118802 | 3300042619 | Bacteria | 3179 |
| 94 | Ga0415639_166597 | 3300038395 | Bacteria | 1580 |
| 95 | Ga0466707_383623 | 3300042601 | Bacteria | 1549 |
| 96 | Ga0466716_090573 | 3300042605 | Bacteria | 3047 |
| 97 | Ga0466722_197463 | 3300042609 | Bacteria | 9020 |
| 98 | Ga0466722_257521 | 3300042609 | Bacteria | 4888 |
| 99 | Ga0123355_10005406 | 3300009826 | Bacteria | 18684 |
| 100 | Ga0123355_10101149 | 3300009826 | Bacteria | 4538 |
| 101 | Ga0123353_10103268 | 3300010167 | Bacteria | 4595 |
| 102 | JGI24698J34947_10009128 | 3300002449 | Unclassified | 5443 |
| 103 | JGI24698J34947_10027784 | 3300002449 | Bacteria | 3001 |
| 104 | JGI24698J34947_10061278 | 3300002449 | Unclassified | 1852 |
| 105 | Ga0466712_315446 | 3300042614 | Bacteria | 1908 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 147 | 267 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.