Protein Family IF11838
Metagenome
Isolate
312
Members
83
Samples
279
Scaffolds
275.64
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125692|2781431244|
- Length
- 332 aa
- Sequence
- MMIQNYDNFRNVCVIIFSGVLSEAKSTMRAWHSCLCHPLVKFFRHTFLNKLSCASLTKRKVLNSLFFALFLLFVPIAGQAQEELFPDMSVLGTTDLPTPPGPPVIPFIDLTVRNPATGQEVAFSLQLLLLLTVLTLAPSIIILMTSFLRVSIVLDFIKRALSLQQVPPNQVILGISLFLTVFIMWPTLSTIYNNSIQPLSQGELSVENAYREAEAPLRLFMYRQMGNRAESVRNIRLFMAMRGLDRPNTLADVPTYVLIPTFILNELTVAFKIGILLFIPFIVIDMVVASILMSMGMIMLPPVMISMPFKLILFILVDGWGLLTDQLVRSFL
Sample Types
Isolate
10.6%
Metagenome
89.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Termitidae
30.9%
Kalotermitidae
17.3%
Culicidae
9.9%
Rhinotermitidae
3.7%
Termopsidae
3.7%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
305
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2964266314 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 2 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 3 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 4 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 15 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 16 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 17 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 18 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 33 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 34 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 35 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 8063589291 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 40 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 46 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 47 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 48 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 49 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 57 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 58 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 59 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 60 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 61 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 62 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 63 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 64 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 67 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 68 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 69 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 70 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 71 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 72 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 73 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 74 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 75 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 76 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 77 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 78 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 79 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 80 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 81 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 82 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 83 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_202934 | 3300042612 | Bacteria | 22495 |
| 2 | Ga0466705_224911 | 3300042612 | Bacteria | 5274 |
| 3 | Ga0466705_362882 | 3300042612 | Bacteria | 8490 |
| 4 | Ga0466712_027812 | 3300042614 | Bacteria | 5412 |
| 5 | Ga0466711_448800 | 3300042615 | Bacteria | 6793 |
| 6 | Ga0466715_134736 | 3300042616 | Bacteria | 16696 |
| 7 | Ga0466715_301038 | 3300042616 | Bacteria | 16262 |
| 8 | Ga0466718_020444 | 3300042617 | Bacteria | 17811 |
| 9 | Ga0466718_072216 | 3300042617 | Bacteria | 1528 |
| 10 | Ga0466723_121215 | 3300042618 | Bacteria | 1698 |
| 11 | Ga0466723_178892 | 3300042618 | Bacteria | 3520 |
| 12 | Ga0466726_037884 | 3300042619 | Bacteria | 4125 |
| 13 | Ga0466726_381747 | 3300042619 | Bacteria | 1599 |
| 14 | Ga0264413_111664 | 3300024493 | Bacteria | 2031 |
| 15 | Ga0466691_043505 | 3300042593 | Bacteria | 8840 |
| 16 | Ga0466696_492062 | 3300042596 | Bacteria | 2460 |
| 17 | Ga0466699_259747 | 3300042597 | Bacteria | 40751 |
| 18 | Ga0466702_298106 | 3300042635 | Bacteria | 4104 |
| 19 | Ga0466703_187864 | 3300042636 | Bacteria | 71803 |
| 20 | Ga0466703_216766 | 3300042636 | Bacteria | 2020 |
| 21 | Ga0466704_129323 | 3300042643 | Bacteria | 30783 |
| 22 | Ga0466704_170845 | 3300042643 | Bacteria | 10005 |
| 23 | Ga0466704_179109 | 3300042643 | Bacteria | 1727 |
| 24 | Ga0466708_111503 | 3300042652 | Bacteria | 12449 |
| 25 | Ga0466708_262169 | 3300042652 | Bacteria | 29232 |
| 26 | Ga0123356_10000569 | 3300010049 | Bacteria | 41050 |
| 27 | Ga0123356_10003499 | 3300010049 | Bacteria | 16432 |
| 28 | Ga0123356_10408629 | 3300010049 | Bacteria | 1497 |
| 29 | Ga0123353_10481396 | 3300010167 | Bacteria | 1816 |
| 30 | Ga0466700_299825 | 3300042600 | Bacteria | 3059 |
| 31 | Ga0466719_145616 | 3300042606 | Bacteria | 7904 |
| 32 | JGI24695J34938_10007663 | 3300002450 | Bacteria | 6274 |
| 33 | JGI24695J34938_10013153 | 3300002450 | Bacteria | 4357 |
| 34 | Ga0072941_1077224 | 3300005201 | Bacteria | 7337 |
| 35 | Ga0072941_1081978 | 3300005201 | Bacteria | 3737 |
| 36 | Ga0466705_151059 | 3300042612 | Bacteria | 39890 |
| 37 | Ga0466705_201714 | 3300042612 | Bacteria | 11942 |
| 38 | Ga0466705_299089 | 3300042612 | Bacteria | 7633 |
| 39 | Ga0466712_114503 | 3300042614 | Bacteria | 2796 |
| 40 | Ga0466715_114864 | 3300042616 | Bacteria | 21180 |
| 41 | Ga0466715_126826 | 3300042616 | Bacteria | 4369 |
| 42 | Ga0466718_052930 | 3300042617 | Bacteria | 6218 |
| 43 | Ga0466723_053793 | 3300042618 | Bacteria | 4317 |
| 44 | Ga0466723_080933 | 3300042618 | Bacteria | 1527 |
| 45 | Ga0466723_082555 | 3300042618 | Bacteria | 5954 |
| 46 | Ga0466723_205161 | 3300042618 | Bacteria | 4281 |
| 47 | Ga0466726_260004 | 3300042619 | Bacteria | 1518 |
| 48 | Ga0466728_215584 | 3300042620 | Bacteria | 35980 |
| 49 | Ga0466728_403318 | 3300042620 | Bacteria | 13612 |
| 50 | Ga0415639_058779 | 3300038395 | Bacteria | 1369 |
| 51 | Ga0456237_0001355 | 3300041968 | Bacteria | 3890 |
| 52 | Ga0466692_007687 | 3300042591 | Bacteria | 11547 |
| 53 | Ga0466692_052084 | 3300042591 | Bacteria | 1697 |
| 54 | Ga0466693_306429 | 3300042592 | Bacteria | 23893 |
| 55 | Ga0466691_027982 | 3300042593 | Bacteria | 19416 |
| 56 | Ga0466691_072046 | 3300042593 | Bacteria | 19393 |
| 57 | Ga0466691_076945 | 3300042593 | Unclassified | 9637 |
| 58 | Ga0466691_127646 | 3300042593 | Bacteria | 19429 |
| 59 | Ga0466694_104756 | 3300042594 | Bacteria | 1046 |
| 60 | Ga0466696_051902 | 3300042596 | Bacteria | 14744 |
| 61 | Ga0466699_175122 | 3300042597 | Bacteria | 2680 |
| 62 | Ga0466703_093804 | 3300042636 | Bacteria | 20660 |
| 63 | Ga0466709_133062 | 3300042648 | Bacteria | 8143 |
| 64 | Ga0466708_114678 | 3300042652 | Bacteria | 3459 |
| 65 | Ga0466727_168956 | 3300042655 | Bacteria | 1620 |
| 66 | Ga0466701_076946 | 3300042598 | Bacteria | 2439 |
| 67 | Ga0466706_281359 | 3300042599 | Bacteria | 1769 |
| 68 | Ga0466716_159624 | 3300042605 | Bacteria | 15667 |
| 69 | Ga0466719_025755 | 3300042606 | Bacteria | 2322 |
| 70 | Ga0466722_032749 | 3300042609 | Bacteria | 3052 |
| 71 | Ga0466722_042249 | 3300042609 | Bacteria | 9745 |
| 72 | AustNasuHG_c1000148 | 3300000089 | Bacteria | 22158 |
| 73 | AustNasuHG_c1007531 | 3300000089 | Bacteria | 3868 |
| 74 | JGI24698J34947_10003484 | 3300002449 | Bacteria | 8541 |
| 75 | JGI24698J34947_10005449 | 3300002449 | Bacteria | 6985 |
| 76 | JGI24695J34938_10000372 | 3300002450 | Bacteria | 44435 |
| 77 | JGI24695J34938_10006487 | 3300002450 | Bacteria | 7007 |
| 78 | JGI24695J34938_10019349 | 3300002450 | Bacteria | 3378 |
| 79 | JGI24705J35276_12217647 | 3300002504 | Bacteria | 2104 |
| 80 | Ga0068305_10007129 | 3300005083 | Bacteria | 11911 |
| 81 | Ga0466705_106717 | 3300042612 | Bacteria | 1700 |
| 82 | Ga0466705_239411 | 3300042612 | Bacteria | 4582 |
| 83 | Ga0466705_309916 | 3300042612 | Bacteria | 15328 |
| 84 | Ga0466732_154071 | 3300042656 | Bacteria | 1631 |
| 85 | Ga0466712_098726 | 3300042614 | Bacteria | 4953 |
| 86 | Ga0466711_501168 | 3300042615 | Bacteria | 17841 |
| 87 | Ga0466718_018037 | 3300042617 | Bacteria | 12353 |
| 88 | Ga0466718_124583 | 3300042617 | Bacteria | 2038 |
| 89 | Ga0466723_013333 | 3300042618 | Bacteria | 24235 |
| 90 | Ga0466726_176246 | 3300042619 | Bacteria | 2292 |
| 91 | Ga0466726_375973 | 3300042619 | Bacteria | 1148 |
| 92 | Ga0466728_007179 | 3300042620 | Bacteria | 31291 |
| 93 | Ga0466690_071198 | 3300042590 | Bacteria | 1871 |
| 94 | Ga0466690_145759 | 3300042590 | Bacteria | 14180 |
| 95 | Ga0466690_397789 | 3300042590 | Bacteria | 1436 |
| 96 | Ga0466694_281332 | 3300042594 | Bacteria | 3929 |
| 97 | Ga0466696_043616 | 3300042596 | Bacteria | 14161 |
| 98 | Ga0466696_438173 | 3300042596 | Bacteria | 17913 |
| 99 | Ga0466735_162359 | 3300042624 | Bacteria | 1260 |
| 100 | Ga0466703_100138 | 3300042636 | Bacteria | 36780 |
| 101 | Ga0466704_390464 | 3300042643 | Bacteria | 33596 |
| 102 | Ga0466709_258556 | 3300042648 | Bacteria | 37873 |
| 103 | Ga0466708_041843 | 3300042652 | Bacteria | 23218 |
| 104 | Ga0466708_148678 | 3300042652 | Bacteria | 2565 |
| 105 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 106 | Ga0123356_10006960 | 3300010049 | Bacteria | 11351 |
| 107 | Ga0123356_10036325 | 3300010049 | Bacteria | 4602 |
| 108 | Ga0123353_10138153 | 3300010167 | Bacteria | 3907 |
| 109 | Ga0123353_10152372 | 3300010167 | Bacteria | 3689 |
| 110 | Ga0123353_10418395 | 3300010167 | Bacteria | 1987 |
| 111 | Ga0466719_544255 | 3300042606 | Bacteria | 14999 |
| 112 | Ga0466720_005165 | 3300042607 | Bacteria | 1260 |
| 113 | Ga0466720_071933 | 3300042607 | Bacteria | 3288 |
| 114 | JGI24695J34938_10000049 | 3300002450 | Bacteria | 91446 |
| 115 | JGI24695J34938_10001515 | 3300002450 | Bacteria | 19589 |
| 116 | JGI24702J35022_10069862 | 3300002462 | Bacteria | 1890 |
| 117 | JGI24700J35501_10930839 | 3300002508 | Bacteria | 26961 |
| 118 | Ga0466711_007809 | 3300042615 | Bacteria | 2539 |
| 119 | Ga0466715_462513 | 3300042616 | Bacteria | 17159 |
| 120 | Ga0466718_100531 | 3300042617 | Bacteria | 8694 |
| 121 | Ga0466723_146734 | 3300042618 | Bacteria | 17606 |
| 122 | Ga0466723_199918 | 3300042618 | Bacteria | 15235 |
| 123 | Ga0466726_335483 | 3300042619 | Bacteria | 23284 |
| 124 | Ga0415639_057183 | 3300038395 | Bacteria | 4368 |
| 125 | Ga0466690_128699 | 3300042590 | Bacteria | 3763 |
| 126 | Ga0466691_056863 | 3300042593 | Bacteria | 29448 |
| 127 | Ga0466696_024094 | 3300042596 | Bacteria | 4997 |
| 128 | Ga0466699_122462 | 3300042597 | Bacteria | 1192 |
| 129 | Ga0466703_100031 | 3300042636 | Bacteria | 16272 |
| 130 | Ga0466703_409388 | 3300042636 | Bacteria | 18630 |
| 131 | Ga0466709_402198 | 3300042648 | Bacteria | 9829 |
| 132 | Ga0466708_409719 | 3300042652 | Bacteria | 26683 |
| 133 | Ga0466727_106836 | 3300042655 | Bacteria | 3565 |
| 134 | Ga0466727_291573 | 3300042655 | Bacteria | 4468 |
| 135 | Ga0123356_10000301 | 3300010049 | Bacteria | 56748 |
| 136 | Ga0123356_10062792 | 3300010049 | Bacteria | 3470 |
| 137 | Ga0123356_10127911 | 3300010049 | Bacteria | 2483 |
| 138 | Ga0123353_10497890 | 3300010167 | Bacteria | 1777 |
| 139 | Ga0123353_11294368 | 3300010167 | Bacteria | 947 |
| 140 | Ga0466716_062301 | 3300042605 | Bacteria | 16665 |
| 141 | Ga0466716_289947 | 3300042605 | Bacteria | 19027 |
| 142 | Ga0466719_238736 | 3300042606 | Unclassified | 7668 |
| 143 | Ga0466720_088372 | 3300042607 | Bacteria | 1313 |
| 144 | Ga0466722_034050 | 3300042609 | Bacteria | 24222 |
| 145 | AustNasuHG_c1018586 | 3300000089 | Bacteria | 2292 |
| 146 | JGI24698J34947_10004036 | 3300002449 | Bacteria | 7976 |
| 147 | JGI24698J34947_10006018 | 3300002449 | Bacteria | 6660 |
| 148 | JGI24695J34938_10012918 | 3300002450 | Bacteria | 4405 |
| 149 | JGI24695J34938_10078920 | 3300002450 | Bacteria | 1362 |
| 150 | Ga0074263_103012 | 3300005485 | Unclassified | 1961 |
| 151 | Ga0466732_426850 | 3300042656 | Bacteria | 6190 |
| 152 | Ga0466712_047820 | 3300042614 | Bacteria | 10078 |
| 153 | Ga0466715_078720 | 3300042616 | Bacteria | 4725 |
| 154 | Ga0466718_016659 | 3300042617 | Bacteria | 5098 |
| 155 | Ga0466718_150179 | 3300042617 | Bacteria | 1676 |
| 156 | Ga0466723_353869 | 3300042618 | Bacteria | 5862 |
| 157 | Ga0264413_105606 | 3300024493 | Bacteria | 14155 |
| 158 | Ga0466691_208499 | 3300042593 | Bacteria | 2849 |
| 159 | Ga0466694_382858 | 3300042594 | Bacteria | 12554 |
| 160 | Ga0466696_388549 | 3300042596 | Bacteria | 3757 |
| 161 | Ga0466703_090251 | 3300042636 | Bacteria | 3216 |
| 162 | Ga0466703_406009 | 3300042636 | Bacteria | 3851 |
| 163 | Ga0466704_114903 | 3300042643 | Bacteria | 80354 |
| 164 | Ga0466704_379885 | 3300042643 | Bacteria | 13731 |
| 165 | Ga0466709_011260 | 3300042648 | Bacteria | 85794 |
| 166 | Ga0466708_248652 | 3300042652 | Bacteria | 2438 |
| 167 | Ga0123353_10001400 | 3300010167 | Bacteria | 29524 |
| 168 | Ga0123353_10503990 | 3300010167 | Bacteria | 1763 |
| 169 | Ga0466706_201757 | 3300042599 | Bacteria | 2727 |
| 170 | Ga0466716_382805 | 3300042605 | Bacteria | 32182 |
| 171 | Ga0466719_222748 | 3300042606 | Bacteria | 2418 |
| 172 | Ga0466720_124974 | 3300042607 | Bacteria | 15988 |
| 173 | Ga0466722_235515 | 3300042609 | Bacteria | 1415 |
| 174 | JGI24698J34947_10029031 | 3300002449 | Bacteria | 2925 |
| 175 | JGI24695J34938_10001539 | 3300002450 | Bacteria | 19431 |
| 176 | JGI24695J34938_10001608 | 3300002450 | Bacteria | 19006 |
| 177 | JGI24695J34938_10005360 | 3300002450 | Bacteria | 8020 |
| 178 | Ga0466705_377473 | 3300042612 | Bacteria | 16281 |
| 179 | Ga0466732_367786 | 3300042656 | Bacteria | 6528 |
| 180 | Ga0466712_135548 | 3300042614 | Bacteria | 1134 |
| 181 | Ga0466718_161664 | 3300042617 | Bacteria | 3850 |
| 182 | Ga0466726_043168 | 3300042619 | Bacteria | 1064 |
| 183 | Ga0466726_328966 | 3300042619 | Bacteria | 2911 |
| 184 | Ga0264413_105605 | 3300024493 | Bacteria | 26648 |
| 185 | Ga0415639_007861 | 3300038395 | Bacteria | 10721 |
| 186 | Ga0415639_058778 | 3300038395 | Bacteria | 2872 |
| 187 | Ga0466690_024047 | 3300042590 | Bacteria | 5243 |
| 188 | Ga0466690_230211 | 3300042590 | Bacteria | 6260 |
| 189 | Ga0466693_256412 | 3300042592 | Bacteria | 4323 |
| 190 | Ga0466696_326102 | 3300042596 | Bacteria | 1179 |
| 191 | Ga0466699_000136 | 3300042597 | Bacteria | 10499 |
| 192 | Ga0466699_358350 | 3300042597 | Bacteria | 4545 |
| 193 | Ga0466702_021043 | 3300042635 | Bacteria | 12351 |
| 194 | Ga0466703_230122 | 3300042636 | Bacteria | 18394 |
| 195 | Ga0466703_432476 | 3300042636 | Bacteria | 8813 |
| 196 | Ga0466704_197186 | 3300042643 | Bacteria | 8845 |
| 197 | Ga0466704_313215 | 3300042643 | Bacteria | 29544 |
| 198 | Ga0466709_273110 | 3300042648 | Bacteria | 6786 |
| 199 | Ga0466708_334784 | 3300042652 | Bacteria | 5489 |
| 200 | Ga0123356_10001692 | 3300010049 | Bacteria | 24136 |
| 201 | Ga0123353_10255040 | 3300010167 | Bacteria | 2713 |
| 202 | Ga0466700_193881 | 3300042600 | Bacteria | 1351 |
| 203 | Ga0466719_046581 | 3300042606 | Bacteria | 1410 |
| 204 | Ga0466719_481253 | 3300042606 | Bacteria | 1904 |
| 205 | JGI24695J34938_10005081 | 3300002450 | Bacteria | 8357 |
| 206 | JGI24702J35022_10036084 | 3300002462 | Bacteria | 2642 |
| 207 | Ga0466705_330729 | 3300042612 | Bacteria | 21437 |
| 208 | Ga0466732_152146 | 3300042656 | Bacteria | 1115 |
| 209 | Ga0466732_242187 | 3300042656 | Bacteria | 1624 |
| 210 | Ga0466712_079124 | 3300042614 | Bacteria | 12600 |
| 211 | Ga0466712_139157 | 3300042614 | Bacteria | 70891 |
| 212 | Ga0466712_274858 | 3300042614 | Bacteria | 49650 |
| 213 | Ga0466726_273718 | 3300042619 | Bacteria | 1957 |
| 214 | Ga0264413_100706 | 3300024493 | Bacteria | 38319 |
| 215 | Ga0466690_414967 | 3300042590 | Bacteria | 3703 |
| 216 | Ga0466691_156091 | 3300042593 | Bacteria | 30300 |
| 217 | Ga0466696_077502 | 3300042596 | Bacteria | 8017 |
| 218 | Ga0466696_427329 | 3300042596 | Bacteria | 3464 |
| 219 | Ga0466699_138301 | 3300042597 | Bacteria | 6928 |
| 220 | Ga0466731_134154 | 3300042622 | Bacteria | 2146 |
| 221 | Ga0466734_144305 | 3300042623 | Bacteria | 1563 |
| 222 | Ga0466735_100236 | 3300042624 | Bacteria | 1502 |
| 223 | Ga0466703_096252 | 3300042636 | Bacteria | 8173 |
| 224 | Ga0466704_101742 | 3300042643 | Bacteria | 17383 |
| 225 | Ga0466704_153727 | 3300042643 | Bacteria | 5987 |
| 226 | Ga0466704_576026 | 3300042643 | Bacteria | 13368 |
| 227 | Ga0466708_019477 | 3300042652 | Bacteria | 2436 |
| 228 | Ga0466708_069525 | 3300042652 | Bacteria | 63222 |
| 229 | Ga0466727_040438 | 3300042655 | Bacteria | 2014 |
| 230 | Ga0466727_322355 | 3300042655 | Bacteria | 20773 |
| 231 | Ga0123356_10000840 | 3300010049 | Bacteria | 34118 |
| 232 | Ga0123356_10513633 | 3300010049 | Bacteria | 1356 |
| 233 | Ga0123353_10057077 | 3300010167 | Bacteria | 6252 |
| 234 | Ga0466706_179698 | 3300042599 | Bacteria | 1986 |
| 235 | Ga0466716_051306 | 3300042605 | Bacteria | 15674 |
| 236 | Ga0466719_236506 | 3300042606 | Bacteria | 21926 |
| 237 | Ga0466720_024003 | 3300042607 | Bacteria | 2719 |
| 238 | Ga0466720_093170 | 3300042607 | Bacteria | 3007 |
| 239 | Ga0466720_232902 | 3300042607 | Bacteria | 1615 |
| 240 | Ga0466721_231479 | 3300042608 | Bacteria | 2612 |
| 241 | Ga0466722_009932 | 3300042609 | Bacteria | 19464 |
| 242 | Ga0466722_031083 | 3300042609 | Bacteria | 44330 |
| 243 | JGI24698J34947_10035574 | 3300002449 | Bacteria | 2599 |
| 244 | JGI24695J34938_10004178 | 3300002450 | Bacteria | 9610 |
| 245 | Ga0072940_1009635 | 3300005200 | Bacteria | 24559 |
| 246 | Ga0466732_137139 | 3300042656 | Bacteria | 1397 |
| 247 | Ga0466733_071758 | 3300042659 | Bacteria | 29788 |
| 248 | Ga0466711_209529 | 3300042615 | Bacteria | 13626 |
| 249 | Ga0466711_406506 | 3300042615 | Bacteria | 4102 |
| 250 | Ga0466715_161137 | 3300042616 | Unclassified | 2610 |
| 251 | Ga0466715_360152 | 3300042616 | Bacteria | 1615 |
| 252 | Ga0466723_002161 | 3300042618 | Bacteria | 18391 |
| 253 | Ga0466723_156872 | 3300042618 | Unclassified | 6024 |
| 254 | Ga0466723_162917 | 3300042618 | Bacteria | 35021 |
| 255 | Ga0466726_098494 | 3300042619 | Bacteria | 33073 |
| 256 | Ga0466726_382659 | 3300042619 | Bacteria | 18394 |
| 257 | Ga0466728_184717 | 3300042620 | Bacteria | 25131 |
| 258 | Ga0466728_235684 | 3300042620 | Unclassified | 2843 |
| 259 | Ga0264413_100708 | 3300024493 | Unclassified | 9638 |
| 260 | Ga0466690_123082 | 3300042590 | Bacteria | 18470 |
| 261 | Ga0466690_288726 | 3300042590 | Bacteria | 4528 |
| 262 | Ga0466691_046406 | 3300042593 | Bacteria | 16023 |
| 263 | Ga0466691_089834 | 3300042593 | Bacteria | 2370 |
| 264 | Ga0466691_098735 | 3300042593 | Bacteria | 8333 |
| 265 | Ga0466691_217417 | 3300042593 | Bacteria | 1822 |
| 266 | Ga0466694_050341 | 3300042594 | Bacteria | 20298 |
| 267 | Ga0466696_169065 | 3300042596 | Bacteria | 24365 |
| 268 | Ga0466703_228714 | 3300042636 | Bacteria | 9230 |
| 269 | Ga0466704_030725 | 3300042643 | Bacteria | 6486 |
| 270 | Ga0466709_322778 | 3300042648 | Bacteria | 1444 |
| 271 | Ga0466727_102090 | 3300042655 | Bacteria | 1981 |
| 272 | Ga0123356_10022834 | 3300010049 | Bacteria | 5900 |
| 273 | Ga0466707_395941 | 3300042601 | Bacteria | 1881 |
| 274 | Ga0466719_023777 | 3300042606 | Bacteria | 34238 |
| 275 | Ga0466719_244795 | 3300042606 | Bacteria | 6181 |
| 276 | Ga0466719_309523 | 3300042606 | Bacteria | 14707 |
| 277 | Ga0466720_228444 | 3300042607 | Bacteria | 1245 |
| 278 | JGI24698J34947_10033149 | 3300002449 | Bacteria | 2711 |
| 279 | JGI24702J35022_10002005 | 3300002462 | Bacteria | 12553 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00813 | FliP | FliP family | 130 | 327 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.