Protein Family IF11814
Metagenome
Isolate
183
Members
57
Samples
173
Scaffolds
423.04
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125681|2781407486|
- Length
- 485 aa
- Sequence
- LRLKCCYCTYHCNGKNRQKAQRPLHYTSISLPGVENKIAARPIPFPRLLLYSGTMNDDIRRALCENYCEPVRDMLWGHIYLTPALAAITQSAPFMRLHRIMQLGPTFMVYPGATHTRASHSIGVYHLARRLLCHLAGQGADSWLSAEGVKSFLCAALLHDAGHFPYTHSLKELPLKDHESLTASLIVSEPLKSLISAAGGDPYMAAAIVDTQAESGGGSGGSADGEVLFYRRLLSGALDPDKLDYLSRDGRYCGVPYGAQDVDFIFSRLQPDRERGVVIDSRGIPAVESLLFAKYLMYRAVYWHKAVRSATAMIKKALFAALESRAIAPEELYNLDDQGLFARAAARACPLFSLAESVKNGRFFTLAAEIPFNEHAHGDALRLSARPRMEESLAQALSPCLGTALRADELIIDVGEPVSFESGLFVTDENCLFSEGSSVFKGSFPDAFATSLRTIRIFVEPGFERDIEKSREGILHTAEKWLTLL
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.4%
Kalotermitidae
25.5%
Unclassified
20.0%
Termopsidae
7.3%
Rhinotermitidae
7.3%
Blaberidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 14 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 17 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 18 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 55 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10000013 | 3300002450 | Bacteria | 122387 |
| 2 | JGI24695J34938_10009049 | 3300002450 | Bacteria | 5580 |
| 3 | Ga0068302_10051253 | 3300005071 | Bacteria | 3099 |
| 4 | Ga0466711_509107 | 3300042615 | Bacteria | 1925 |
| 5 | Ga0466723_122079 | 3300042618 | Bacteria | 5702 |
| 6 | Ga0466723_166091 | 3300042618 | Bacteria | 8165 |
| 7 | Ga0466728_191402 | 3300042620 | Bacteria | 14340 |
| 8 | Ga0466735_072806 | 3300042624 | Bacteria | 12912 |
| 9 | Ga0466704_412183 | 3300042643 | Bacteria | 2235 |
| 10 | Ga0466708_111799 | 3300042652 | Bacteria | 28295 |
| 11 | Ga0466727_162737 | 3300042655 | Bacteria | 1727 |
| 12 | Ga0466727_253025 | 3300042655 | Bacteria | 2639 |
| 13 | Ga0415639_001719 | 3300038395 | Bacteria | 19674 |
| 14 | Ga0466696_499418 | 3300042596 | Bacteria | 3028 |
| 15 | Ga0466699_435306 | 3300042597 | Bacteria | 2953 |
| 16 | Ga0466722_013559 | 3300042609 | Bacteria | 8177 |
| 17 | Ga0466722_082473 | 3300042609 | Bacteria | 31404 |
| 18 | Ga0466705_344293 | 3300042612 | Bacteria | 7980 |
| 19 | Ga0466733_005128 | 3300042659 | Bacteria | 4190 |
| 20 | JGI24695J34938_10002992 | 3300002450 | Bacteria | 12175 |
| 21 | Ga0466705_425024 | 3300042612 | Bacteria | 3694 |
| 22 | Ga0466711_031615 | 3300042615 | Unclassified | 6969 |
| 23 | Ga0466726_245815 | 3300042619 | Bacteria | 2901 |
| 24 | Ga0466726_489544 | 3300042619 | Bacteria | 2803 |
| 25 | Ga0466728_115604 | 3300042620 | Bacteria | 3221 |
| 26 | Ga0466729_037172 | 3300042621 | Bacteria | 4895 |
| 27 | Ga0466731_257601 | 3300042622 | Bacteria | 2462 |
| 28 | Ga0466735_086953 | 3300042624 | Bacteria | 4887 |
| 29 | Ga0466735_091395 | 3300042624 | Bacteria | 3678 |
| 30 | Ga0466735_205217 | 3300042624 | Bacteria | 1518 |
| 31 | Ga0466703_213128 | 3300042636 | Bacteria | 9079 |
| 32 | Ga0466704_117745 | 3300042643 | Bacteria | 2337 |
| 33 | Ga0466704_537498 | 3300042643 | Unclassified | 5974 |
| 34 | Ga0466709_259608 | 3300042648 | Bacteria | 8752 |
| 35 | Ga0466708_020232 | 3300042652 | Bacteria | 68940 |
| 36 | Ga0466690_190397 | 3300042590 | Bacteria | 8163 |
| 37 | Ga0466699_021772 | 3300042597 | Bacteria | 7324 |
| 38 | Ga0466699_195846 | 3300042597 | Bacteria | 7086 |
| 39 | Ga0123353_10101124 | 3300010167 | Bacteria | 4647 |
| 40 | Ga0123353_10132365 | 3300010167 | Bacteria | 4001 |
| 41 | Ga0123353_10388108 | 3300010167 | Bacteria | 2085 |
| 42 | Ga0466716_162561 | 3300042605 | Unclassified | 6350 |
| 43 | Ga0466719_299197 | 3300042606 | Bacteria | 7351 |
| 44 | Ga0466722_161964 | 3300042609 | Bacteria | 9253 |
| 45 | Ga0466722_197120 | 3300042609 | Bacteria | 8691 |
| 46 | JGI24698J34947_10028894 | 3300002449 | Bacteria | 2934 |
| 47 | Ga0466711_507069 | 3300042615 | Bacteria | 12280 |
| 48 | Ga0466723_067599 | 3300042618 | Bacteria | 49452 |
| 49 | Ga0466726_393929 | 3300042619 | Bacteria | 1820 |
| 50 | Ga0466704_177135 | 3300042643 | Bacteria | 5770 |
| 51 | Ga0466704_366974 | 3300042643 | Bacteria | 3457 |
| 52 | Ga0466727_247113 | 3300042655 | Bacteria | 6478 |
| 53 | Ga0264413_101672 | 3300024493 | Bacteria | 9287 |
| 54 | Ga0466692_059576 | 3300042591 | Bacteria | 31204 |
| 55 | Ga0466692_155795 | 3300042591 | Bacteria | 10948 |
| 56 | Ga0466696_189327 | 3300042596 | Bacteria | 5609 |
| 57 | Ga0466696_219304 | 3300042596 | Bacteria | 7061 |
| 58 | Ga0466699_191775 | 3300042597 | Bacteria | 8516 |
| 59 | Ga0466714_167860 | 3300042603 | Bacteria | 7386 |
| 60 | Ga0466733_199864 | 3300042659 | Bacteria | 4258 |
| 61 | JGI24695J34938_10007055 | 3300002450 | Bacteria | 6646 |
| 62 | Ga0466718_149328 | 3300042617 | Bacteria | 9484 |
| 63 | Ga0466723_029135 | 3300042618 | Bacteria | 2068 |
| 64 | Ga0466703_288386 | 3300042636 | Bacteria | 6099 |
| 65 | Ga0466709_099530 | 3300042648 | Bacteria | 2242 |
| 66 | Ga0466708_009753 | 3300042652 | Bacteria | 3762 |
| 67 | Ga0466693_032981 | 3300042592 | Bacteria | 51645 |
| 68 | Ga0466696_011429 | 3300042596 | Bacteria | 10032 |
| 69 | Ga0466699_079254 | 3300042597 | Bacteria | 2173 |
| 70 | Ga0466699_247881 | 3300042597 | Bacteria | 2673 |
| 71 | Ga0123355_10000286 | 3300009826 | Bacteria | 64768 |
| 72 | Ga0466713_110332 | 3300042602 | Bacteria | 5684 |
| 73 | Ga0466716_063393 | 3300042605 | Bacteria | 14618 |
| 74 | Ga0466705_050508 | 3300042612 | Bacteria | 4964 |
| 75 | AustNasuHG_c1006056 | 3300000089 | Bacteria | 4320 |
| 76 | JGI24698J34947_10002441 | 3300002449 | Bacteria | 10013 |
| 77 | Ga0466715_014207 | 3300042616 | Bacteria | 16080 |
| 78 | Ga0466715_381125 | 3300042616 | Bacteria | 4286 |
| 79 | Ga0466718_004456 | 3300042617 | Bacteria | 7697 |
| 80 | Ga0466723_044054 | 3300042618 | Bacteria | 6709 |
| 81 | Ga0466723_100840 | 3300042618 | Bacteria | 26748 |
| 82 | Ga0466728_154082 | 3300042620 | Bacteria | 4123 |
| 83 | Ga0466729_299260 | 3300042621 | Bacteria | 3299 |
| 84 | Ga0466702_251188 | 3300042635 | Bacteria | 2930 |
| 85 | Ga0466703_195995 | 3300042636 | Bacteria | 7235 |
| 86 | Ga0466703_235899 | 3300042636 | Bacteria | 23764 |
| 87 | Ga0466704_015776 | 3300042643 | Bacteria | 5664 |
| 88 | Ga0466704_110734 | 3300042643 | Unclassified | 9807 |
| 89 | Ga0466704_183081 | 3300042643 | Bacteria | 7416 |
| 90 | Ga0466704_424800 | 3300042643 | Bacteria | 7701 |
| 91 | Ga0466709_167670 | 3300042648 | Bacteria | 6316 |
| 92 | Ga0466709_338748 | 3300042648 | Bacteria | 2204 |
| 93 | Ga0264413_135444 | 3300024493 | Bacteria | 8551 |
| 94 | Ga0466690_142656 | 3300042590 | Bacteria | 2817 |
| 95 | Ga0466691_087298 | 3300042593 | Bacteria | 6685 |
| 96 | Ga0466691_227462 | 3300042593 | Bacteria | 4972 |
| 97 | Ga0466696_414094 | 3300042596 | Bacteria | 2429 |
| 98 | Ga0123355_10049231 | 3300009826 | Bacteria | 6852 |
| 99 | Ga0123355_10219908 | 3300009826 | Bacteria | 2734 |
| 100 | Ga0466716_007119 | 3300042605 | Bacteria | 4240 |
| 101 | Ga0466719_274664 | 3300042606 | Bacteria | 7523 |
| 102 | Ga0466720_014621 | 3300042607 | Bacteria | 102324 |
| 103 | Ga0466722_054524 | 3300042609 | Bacteria | 1808 |
| 104 | Ga0466722_149888 | 3300042609 | Bacteria | 10566 |
| 105 | Ga0466722_224137 | 3300042609 | Bacteria | 2471 |
| 106 | Ga0466732_189863 | 3300042656 | Bacteria | 5370 |
| 107 | AustNasuHG_c1003066 | 3300000089 | Bacteria | 6026 |
| 108 | Ga0466712_138271 | 3300042614 | Bacteria | 13571 |
| 109 | Ga0466711_107323 | 3300042615 | Bacteria | 7677 |
| 110 | Ga0466715_066854 | 3300042616 | Bacteria | 6116 |
| 111 | Ga0466723_195953 | 3300042618 | Bacteria | 7073 |
| 112 | Ga0466728_121813 | 3300042620 | Bacteria | 2629 |
| 113 | Ga0466728_122042 | 3300042620 | Unclassified | 2502 |
| 114 | Ga0466708_340197 | 3300042652 | Bacteria | 51194 |
| 115 | Ga0466708_437744 | 3300042652 | Bacteria | 51835 |
| 116 | Ga0466727_210023 | 3300042655 | Bacteria | 3634 |
| 117 | Ga0466727_243084 | 3300042655 | Bacteria | 8470 |
| 118 | Ga0466690_151401 | 3300042590 | Bacteria | 12638 |
| 119 | Ga0466694_271629 | 3300042594 | Bacteria | 6847 |
| 120 | Ga0466696_004747 | 3300042596 | Bacteria | 4797 |
| 121 | Ga0466699_172193 | 3300042597 | Bacteria | 17697 |
| 122 | Ga0466707_296992 | 3300042601 | Bacteria | 4132 |
| 123 | Ga0466707_379252 | 3300042601 | Bacteria | 5351 |
| 124 | Ga0466713_044982 | 3300042602 | Bacteria | 3358 |
| 125 | Ga0466720_110599 | 3300042607 | Bacteria | 7340 |
| 126 | Ga0466720_143785 | 3300042607 | Bacteria | 9849 |
| 127 | Ga0466698_180637 | 3300042610 | Bacteria | 1349 |
| 128 | JGI24702J35022_10019232 | 3300002462 | Unclassified | 3715 |
| 129 | Ga0466711_178740 | 3300042615 | Bacteria | 3536 |
| 130 | Ga0466711_181310 | 3300042615 | Bacteria | 18546 |
| 131 | Ga0466711_445019 | 3300042615 | Bacteria | 49797 |
| 132 | Ga0466715_026836 | 3300042616 | Bacteria | 2352 |
| 133 | Ga0466723_110770 | 3300042618 | Bacteria | 12010 |
| 134 | Ga0466723_240146 | 3300042618 | Bacteria | 11432 |
| 135 | Ga0466723_277331 | 3300042618 | Bacteria | 9909 |
| 136 | Ga0466728_053339 | 3300042620 | Bacteria | 4467 |
| 137 | Ga0466735_074907 | 3300042624 | Bacteria | 3626 |
| 138 | Ga0466735_099903 | 3300042624 | Bacteria | 15007 |
| 139 | Ga0466735_196606 | 3300042624 | Bacteria | 5002 |
| 140 | Ga0466708_291525 | 3300042652 | Bacteria | 19495 |
| 141 | Ga0264413_101674 | 3300024493 | Bacteria | 16699 |
| 142 | Ga0466691_216612 | 3300042593 | Bacteria | 8410 |
| 143 | Ga0466696_433920 | 3300042596 | Bacteria | 4819 |
| 144 | Ga0466699_073794 | 3300042597 | Bacteria | 8806 |
| 145 | Ga0466699_214657 | 3300042597 | Bacteria | 7396 |
| 146 | Ga0466706_093260 | 3300042599 | Bacteria | 27323 |
| 147 | Ga0466719_146331 | 3300042606 | Bacteria | 13061 |
| 148 | Ga0466719_328708 | 3300042606 | Bacteria | 47326 |
| 149 | Ga0466722_165225 | 3300042609 | Bacteria | 1547 |
| 150 | Ga0466705_031714 | 3300042612 | Bacteria | 8942 |
| 151 | Ga0466705_195811 | 3300042612 | Bacteria | 5858 |
| 152 | Ga0466705_281761 | 3300042612 | Bacteria | 9213 |
| 153 | JGI24695J34938_10002724 | 3300002450 | Bacteria | 13032 |
| 154 | Ga0072941_1045898 | 3300005201 | Bacteria | 6032 |
| 155 | Ga0123357_10002863 | 3300009784 | Bacteria | 19445 |
| 156 | Ga0466711_057516 | 3300042615 | Bacteria | 8983 |
| 157 | Ga0466718_025034 | 3300042617 | Bacteria | 6018 |
| 158 | Ga0466726_286702 | 3300042619 | Bacteria | 1858 |
| 159 | Ga0466703_265699 | 3300042636 | Bacteria | 25659 |
| 160 | Ga0466704_457236 | 3300042643 | Unclassified | 8626 |
| 161 | Ga0466709_303070 | 3300042648 | Bacteria | 12922 |
| 162 | Ga0466708_065604 | 3300042652 | Bacteria | 3169 |
| 163 | Ga0264413_101673 | 3300024493 | Unclassified | 5409 |
| 164 | Ga0415639_045388 | 3300038395 | Bacteria | 6433 |
| 165 | Ga0456237_0005014 | 3300041968 | Bacteria | 2112 |
| 166 | Ga0466690_094153 | 3300042590 | Bacteria | 5182 |
| 167 | Ga0466693_129023 | 3300042592 | Bacteria | 2677 |
| 168 | Ga0466696_361474 | 3300042596 | Bacteria | 23704 |
| 169 | Ga0123353_10004345 | 3300010167 | Bacteria | 18232 |
| 170 | Ga0466707_030102 | 3300042601 | Bacteria | 3101 |
| 171 | Ga0466713_145304 | 3300042602 | Bacteria | 22025 |
| 172 | Ga0466716_210886 | 3300042605 | Unclassified | 5518 |
| 173 | Ga0466719_168309 | 3300042606 | Bacteria | 26888 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.