Protein Family IF11806
Metagenome
Isolate
164
Members
52
Samples
154
Scaffolds
80.24
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125663|2781338700|
- Length
- 91 aa
- Sequence
- MLMRLVLELKQVDKKSISPVIAMITPGIIRLLIENRKLSLEEASGILYNSLLYKTLEDEETKVWRFGYPLLYDLLEEELATGKITFPDEQI
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.9%
Unclassified
21.6%
Kalotermitidae
11.8%
Termopsidae
7.8%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 2 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 5 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 36 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 45 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 46 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_074929 | 3300042611 | Bacteria | 6066 |
| 2 | Ga0466714_012716 | 3300042603 | Bacteria | 1355 |
| 3 | Ga0466717_281167 | 3300042604 | Bacteria | 1773 |
| 4 | Ga0466722_106840 | 3300042609 | Bacteria | 2167 |
| 5 | Ga0466734_118672 | 3300042623 | Archaea | 9505 |
| 6 | Ga0466702_001123 | 3300042635 | Bacteria | 1907 |
| 7 | Ga0466702_038299 | 3300042635 | Bacteria | 1515 |
| 8 | Ga0466702_183166 | 3300042635 | Bacteria | 1065 |
| 9 | Ga0466656_008300 | 3300042550 | Bacteria | 1091 |
| 10 | Ga0466656_162290 | 3300042550 | Bacteria | 1243 |
| 11 | Ga0123357_10154699 | 3300009784 | Bacteria | 2770 |
| 12 | Ga0123357_10691152 | 3300009784 | Bacteria | 735 |
| 13 | Ga0123356_10021285 | 3300010049 | Unclassified | 6123 |
| 14 | Ga0123356_10118205 | 3300010049 | Bacteria | 2573 |
| 15 | Ga0123356_10282852 | 3300010049 | Bacteria | 1755 |
| 16 | Ga0123356_10432595 | 3300010049 | Bacteria | 1460 |
| 17 | Ga0123356_12696451 | 3300010049 | Bacteria | 622 |
| 18 | Ga0123353_10781438 | 3300010167 | Bacteria | 1322 |
| 19 | Ga0123354_10009622 | 3300010882 | Bacteria | 14827 |
| 20 | JGI24702J35022_10426859 | 3300002462 | Bacteria | 804 |
| 21 | Ga0072941_1172024 | 3300005201 | Bacteria | 856 |
| 22 | Ga0466715_214675 | 3300042616 | Bacteria | 5325 |
| 23 | Ga0466718_009450 | 3300042617 | Bacteria | 2464 |
| 24 | Ga0466726_009517 | 3300042619 | Bacteria | 1084 |
| 25 | Ga0466705_137281 | 3300042612 | Bacteria | 4423 |
| 26 | Ga0466733_087064 | 3300042659 | Bacteria | 1453 |
| 27 | Ga0466706_225584 | 3300042599 | Bacteria | 2354 |
| 28 | Ga0466734_033444 | 3300042623 | Bacteria | 1644 |
| 29 | Ga0466727_239688 | 3300042655 | Bacteria | 1026 |
| 30 | Ga0466657_184217 | 3300042582 | Bacteria | 1436 |
| 31 | Ga0466694_341449 | 3300042594 | Unclassified | 1665 |
| 32 | Ga0123357_10166973 | 3300009784 | Bacteria | 2617 |
| 33 | Ga0123355_12159591 | 3300009826 | Bacteria | 510 |
| 34 | Ga0123356_10008056 | 3300010049 | Bacteria | 10484 |
| 35 | Ga0123356_10020406 | 3300010049 | Bacteria | 6269 |
| 36 | Ga0123356_10318947 | 3300010049 | Bacteria | 1666 |
| 37 | Ga0123356_10442655 | 3300010049 | Bacteria | 1446 |
| 38 | Ga0123356_10481473 | 3300010049 | Bacteria | 1394 |
| 39 | Ga0123356_12187035 | 3300010049 | Bacteria | 691 |
| 40 | Ga0123356_12298779 | 3300010049 | Bacteria | 674 |
| 41 | JGI24698J34947_10058157 | 3300002449 | Bacteria | 1916 |
| 42 | JGI24698J34947_10290990 | 3300002449 | Bacteria | 593 |
| 43 | Ga0123357_10003104 | 3300009784 | Bacteria | 18855 |
| 44 | Ga0466705_501841 | 3300042612 | Bacteria | 5644 |
| 45 | Ga0466711_015996 | 3300042615 | Bacteria | 17923 |
| 46 | Ga0466711_034152 | 3300042615 | Bacteria | 1157 |
| 47 | Ga0466711_216454 | 3300042615 | Unclassified | 2057 |
| 48 | Ga0466718_161813 | 3300042617 | Bacteria | 1435 |
| 49 | Ga0466704_607703 | 3300042643 | Bacteria | 1486 |
| 50 | Ga0466727_209091 | 3300042655 | Bacteria | 1595 |
| 51 | Ga0466727_335029 | 3300042655 | Bacteria | 1856 |
| 52 | Ga0466692_052983 | 3300042591 | Bacteria | 19621 |
| 53 | Ga0466699_170883 | 3300042597 | Bacteria | 11701 |
| 54 | Ga0123357_10818328 | 3300009784 | Bacteria | 625 |
| 55 | Ga0123355_10420345 | 3300009826 | Bacteria | 1709 |
| 56 | Ga0123356_10680244 | 3300010049 | Bacteria | 1197 |
| 57 | Ga0123356_10773395 | 3300010049 | Bacteria | 1131 |
| 58 | Ga0123356_12827334 | 3300010049 | Bacteria | 607 |
| 59 | Ga0123353_10002686 | 3300010167 | Bacteria | 22159 |
| 60 | Ga0123353_10759174 | 3300010167 | Bacteria | 1348 |
| 61 | Ga0123353_12788479 | 3300010167 | Bacteria | 573 |
| 62 | Ga0123354_10953973 | 3300010882 | Bacteria | 556 |
| 63 | AustNasuHG_c1000205 | 3300000089 | Bacteria | 19487 |
| 64 | JGI24698J34947_10000596 | 3300002449 | Bacteria | 17257 |
| 65 | JGI24702J35022_10000116 | 3300002462 | Bacteria | 38330 |
| 66 | JGI24702J35022_10084670 | 3300002462 | Bacteria | 1721 |
| 67 | JGI24702J35022_10133435 | 3300002462 | Bacteria | 1380 |
| 68 | Ga0466721_126097 | 3300042608 | Bacteria | 24100 |
| 69 | Ga0466704_355553 | 3300042643 | Bacteria | 8548 |
| 70 | Ga0466727_132024 | 3300042655 | Unclassified | 1021 |
| 71 | Ga0415639_112908 | 3300038395 | Bacteria | 1596 |
| 72 | Ga0466696_240550 | 3300042596 | Bacteria | 1121 |
| 73 | Ga0123355_10005123 | 3300009826 | Bacteria | 19117 |
| 74 | Ga0123356_12010074 | 3300010049 | Bacteria | 721 |
| 75 | Ga0123356_13609915 | 3300010049 | Bacteria | 536 |
| 76 | Ga0123353_10040312 | 3300010167 | Bacteria | 7367 |
| 77 | Ga0123353_11251775 | 3300010167 | Bacteria | 968 |
| 78 | Ga0123353_11902375 | 3300010167 | Bacteria | 734 |
| 79 | Ga0123354_10426304 | 3300010882 | Bacteria | 1097 |
| 80 | JGI24702J35022_10392495 | 3300002462 | Bacteria | 837 |
| 81 | Ga0068302_10399227 | 3300005071 | Bacteria | 786 |
| 82 | Ga0466712_312949 | 3300042614 | Bacteria | 2069 |
| 83 | Ga0466697_180904 | 3300042611 | Bacteria | 2928 |
| 84 | Ga0466697_252036 | 3300042611 | Bacteria | 8291 |
| 85 | Ga0466701_095543 | 3300042598 | Bacteria | 3887 |
| 86 | Ga0466706_010769 | 3300042599 | Bacteria | 8787 |
| 87 | Ga0466694_105399 | 3300042594 | Bacteria | 1355 |
| 88 | Ga0123355_10403274 | 3300009826 | Bacteria | 1762 |
| 89 | Ga0123356_10030205 | 3300010049 | Bacteria | 5072 |
| 90 | Ga0123356_10293586 | 3300010049 | Bacteria | 1727 |
| 91 | Ga0466705_511132 | 3300042612 | Bacteria | 1072 |
| 92 | Ga0466712_024961 | 3300042614 | Unclassified | 3133 |
| 93 | Ga0466726_394515 | 3300042619 | Unclassified | 1075 |
| 94 | Ga0466697_216792 | 3300042611 | Bacteria | 9381 |
| 95 | Ga0466700_128919 | 3300042600 | Bacteria | 1212 |
| 96 | Ga0466721_273193 | 3300042608 | Bacteria | 9674 |
| 97 | Ga0466704_521718 | 3300042643 | Bacteria | 1478 |
| 98 | Ga0466708_111544 | 3300042652 | Bacteria | 1238 |
| 99 | Ga0466725_013893 | 3300042654 | Bacteria | 3070 |
| 100 | Ga0415639_007339 | 3300038395 | Bacteria | 15829 |
| 101 | Ga0466692_153228 | 3300042591 | Bacteria | 29967 |
| 102 | Ga0466694_083268 | 3300042594 | Bacteria | 2018 |
| 103 | Ga0123355_10282513 | 3300009826 | Bacteria | 2289 |
| 104 | Ga0123355_10992137 | 3300009826 | Bacteria | 893 |
| 105 | Ga0123356_10349800 | 3300010049 | Bacteria | 1601 |
| 106 | Ga0123356_10398113 | 3300010049 | Bacteria | 1514 |
| 107 | Ga0123356_11371948 | 3300010049 | Bacteria | 868 |
| 108 | Ga0123353_10912547 | 3300010167 | Bacteria | 1194 |
| 109 | Ga0123354_10708354 | 3300010882 | Bacteria | 701 |
| 110 | JGI24698J34947_10073578 | 3300002449 | Unclassified | 1630 |
| 111 | JGI24702J35022_10049883 | 3300002462 | Unclassified | 2230 |
| 112 | Ga0466721_187392 | 3300042608 | Bacteria | 20917 |
| 113 | Ga0466697_052900 | 3300042611 | Bacteria | 1698 |
| 114 | Ga0466704_525031 | 3300042643 | Bacteria | 2431 |
| 115 | Ga0466699_182944 | 3300042597 | Bacteria | 3725 |
| 116 | Ga0123357_10147999 | 3300009784 | Bacteria | 2861 |
| 117 | Ga0123356_10082531 | 3300010049 | Bacteria | 3043 |
| 118 | Ga0123356_10150835 | 3300010049 | Bacteria | 2307 |
| 119 | Ga0123356_10155455 | 3300010049 | Bacteria | 2277 |
| 120 | Ga0123356_10780924 | 3300010049 | Bacteria | 1126 |
| 121 | Ga0123353_10119856 | 3300010167 | Bacteria | 4231 |
| 122 | Ga0123353_10208266 | 3300010167 | Bacteria | 3069 |
| 123 | Ga0123353_11055521 | 3300010167 | Bacteria | 1085 |
| 124 | Ga0123353_11302705 | 3300010167 | Bacteria | 943 |
| 125 | Ga0123353_12140343 | 3300010167 | Bacteria | 679 |
| 126 | JGI24695J34938_10001368 | 3300002450 | Bacteria | 20999 |
| 127 | JGI24702J35022_10020619 | 3300002462 | Bacteria | 3577 |
| 128 | JGI24702J35022_10828930 | 3300002462 | Bacteria | 576 |
| 129 | JGI24702J35022_10924357 | 3300002462 | Bacteria | 543 |
| 130 | Ga0466718_013533 | 3300042617 | Bacteria | 1039 |
| 131 | Ga0466718_108929 | 3300042617 | Bacteria | 2279 |
| 132 | Ga0466697_130246 | 3300042611 | Bacteria | 1068 |
| 133 | Ga0466705_044372 | 3300042612 | Bacteria | 14386 |
| 134 | Ga0466713_103494 | 3300042602 | Bacteria | 1281 |
| 135 | Ga0466717_044861 | 3300042604 | Bacteria | 1449 |
| 136 | Ga0466721_259809 | 3300042608 | Bacteria | 3468 |
| 137 | Ga0466735_012573 | 3300042624 | Unclassified | 2267 |
| 138 | Ga0466702_463735 | 3300042635 | Bacteria | 1002 |
| 139 | Ga0415639_016161 | 3300038395 | Unclassified | 1206 |
| 140 | Ga0415639_112907 | 3300038395 | Bacteria | 1139 |
| 141 | Ga0466693_417972 | 3300042592 | Bacteria | 3195 |
| 142 | Ga0466699_033071 | 3300042597 | Bacteria | 2226 |
| 143 | Ga0466699_371266 | 3300042597 | Bacteria | 2230 |
| 144 | Ga0123355_10213768 | 3300009826 | Bacteria | 2788 |
| 145 | Ga0123356_10525424 | 3300010049 | Bacteria | 1342 |
| 146 | Ga0123356_11584804 | 3300010049 | Bacteria | 810 |
| 147 | Ga0123356_12577231 | 3300010049 | Bacteria | 637 |
| 148 | Ga0123356_13394870 | 3300010049 | Bacteria | 553 |
| 149 | Ga0123353_10549489 | 3300010167 | Bacteria | 1666 |
| 150 | Ga0123353_11436059 | 3300010167 | Bacteria | 884 |
| 151 | JGI24698J34947_10103780 | 3300002449 | Bacteria | 1271 |
| 152 | JGI24702J35022_10187812 | 3300002462 | Bacteria | 1177 |
| 153 | JGI24702J35022_10275342 | 3300002462 | Bacteria | 986 |
| 154 | JGI24702J35022_10312213 | 3300002462 | Bacteria | 930 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.