Protein Family IF11803
Metagenome
Metatranscriptome
Isolate
315
Members
81
Samples
288
Scaffolds
569.72
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125662|2781336525|
- Length
- 629 aa
- Sequence
- MAKLHLDDLRLFRELKKKDFNKRDAESIQVVIGMGTCGIAAGAKQTWDAFTSGLDASCIVKQTGCMGLCHSEPTVEVIVPGKPSVIYGMVDAALAKEIIQKHIQGNQPGNQPLDNHVLEKPAIDIIKNEADDSSKFQYRVVLRNCGIIDPENIDEYIARDGYSGLEKVLFEWSAEQTIEEMKISALRGRGGAGFPTWLKWDLARKAVSPDGEKYVICNADEGDPGAYMDRSTIEGDPHSVIEGMITAGKAIGANKGYVYIRAEYPLAIERLKIAIDQARDFGLLGENIMFSGFCFDIEIRLGAGAFVCGEETALIKSVEGNRGMPVPKPPFPANKGLWQKPSIINNVETFATVPVITARGGAWHAKIGTEKSKGTKVFALTGKVKHSGLVEVPMGTSLRDIVYKVGGGIMDGKKFKGVQTGGPSGGILTEASLDLPIDFDTLTENGSMMGSGGMIVMDEDDCVVDVSRFYMEFCVDESCGKCSPCRIGTTQTLKLLEKITEGKGTQEDLVSLVAIGNAMTKASLCMLGCTAANPVMSTIKNFIEEYNEHIHDKKCRSGKCKSLLTFTIDTPKCIGCGICVKKCPTNCIIPEDAAKYPDKKKPPVLIKQEGCIKCGECLAVCKFNAVIKA
Sample Types
Isolate
8.6%
Metagenome
91.1%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.2%
Termitidae
36.2%
Kalotermitidae
17.5%
Rhinotermitidae
5.0%
Termopsidae
3.8%
Blaberidae
1.2%
Taxonomy
Archaea
0
Bacteria
295
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 2 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 9 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 21 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 22 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 30 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 31 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 32 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 33 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 34 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 35 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 43 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 44 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 45 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 46 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 47 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 50 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 51 | 2820734335 | Unclassified Chloroflexi Lab288P3bin99 | Isolate | Unclassified |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 57 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 58 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 59 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 63 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 66 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 67 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 68 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 69 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 70 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 71 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 72 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 73 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 74 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 75 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 76 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 77 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 78 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 79 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 80 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 81 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_072668 | 3300042612 | Bacteria | 6038 |
| 2 | Ga0466705_105739 | 3300042612 | Bacteria | 7417 |
| 3 | Ga0466732_426650 | 3300042656 | Bacteria | 5613 |
| 4 | Ga0466692_090508 | 3300042591 | Bacteria | 27273 |
| 5 | Ga0466691_139948 | 3300042593 | Bacteria | 7770 |
| 6 | Ga0466694_007865 | 3300042594 | Bacteria | 6750 |
| 7 | Ga0466694_028653 | 3300042594 | Bacteria | 6354 |
| 8 | Ga0466694_120287 | 3300042594 | Bacteria | 2241 |
| 9 | Ga0466694_314094 | 3300042594 | Bacteria | 2280 |
| 10 | Ga0466699_250433 | 3300042597 | Bacteria | 2000 |
| 11 | AustNasuHG_c1002112 | 3300000089 | Bacteria | 7180 |
| 12 | JGI24695J34938_10010936 | 3300002450 | Bacteria | 4926 |
| 13 | JGI24702J35022_10043771 | 3300002462 | Bacteria | 2385 |
| 14 | Ga0123353_10008642 | 3300010167 | Bacteria | 13939 |
| 15 | Ga0466714_040238 | 3300042603 | Bacteria | 13182 |
| 16 | Ga0466716_019424 | 3300042605 | Bacteria | 2940 |
| 17 | Ga0466719_024851 | 3300042606 | Bacteria | 10321 |
| 18 | Ga0466731_081847 | 3300042622 | Bacteria | 13431 |
| 19 | Ga0466703_025704 | 3300042636 | Bacteria | 95958 |
| 20 | Ga0466703_037472 | 3300042636 | Bacteria | 10768 |
| 21 | Ga0466703_086333 | 3300042636 | Bacteria | 22187 |
| 22 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 23 | Ga0466708_156259 | 3300042652 | Bacteria | 8348 |
| 24 | Ga0466711_214922 | 3300042615 | Bacteria | 11553 |
| 25 | Ga0466715_040568 | 3300042616 | Bacteria | 10722 |
| 26 | Ga0466715_077422 | 3300042616 | Bacteria | 12481 |
| 27 | Ga0466718_033549 | 3300042617 | Bacteria | 4489 |
| 28 | Ga0466718_069599 | 3300042617 | Bacteria | 21116 |
| 29 | Ga0466723_249816 | 3300042618 | Bacteria | 11759 |
| 30 | Ga0466723_309262 | 3300042618 | Bacteria | 5688 |
| 31 | Ga0466728_033603 | 3300042620 | Bacteria | 11487 |
| 32 | Ga0466705_039531 | 3300042612 | Bacteria | 10269 |
| 33 | Ga0466732_316918 | 3300042656 | Bacteria | 8246 |
| 34 | Ga0466690_084793 | 3300042590 | Bacteria | 8560 |
| 35 | Ga0466690_408018 | 3300042590 | Unclassified | 5401 |
| 36 | Ga0466692_091386 | 3300042591 | Bacteria | 4740 |
| 37 | Ga0466693_418796 | 3300042592 | Unclassified | 5428 |
| 38 | Ga0466691_027677 | 3300042593 | Bacteria | 11838 |
| 39 | Ga0466696_168452 | 3300042596 | Bacteria | 15050 |
| 40 | Ga0466699_009887 | 3300042597 | Bacteria | 7645 |
| 41 | AustNasuHG_c1000541 | 3300000089 | Bacteria | 13265 |
| 42 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 43 | JGI24695J34938_10000191 | 3300002450 | Bacteria | 57182 |
| 44 | JGI24702J35022_10000456 | 3300002462 | Bacteria | 24608 |
| 45 | Ga0068305_10139831 | 3300005083 | Bacteria | 6677 |
| 46 | Ga0123357_10028455 | 3300009784 | Bacteria | 7564 |
| 47 | Ga0123356_10016017 | 3300010049 | Bacteria | 7167 |
| 48 | Ga0123353_10244197 | 3300010167 | Bacteria | 2787 |
| 49 | Ga0466707_317312 | 3300042601 | Bacteria | 12113 |
| 50 | Ga0466714_022567 | 3300042603 | Bacteria | 13398 |
| 51 | Ga0466716_127372 | 3300042605 | Bacteria | 4017 |
| 52 | Ga0466719_002721 | 3300042606 | Bacteria | 11302 |
| 53 | Ga0466719_117294 | 3300042606 | Bacteria | 3376 |
| 54 | Ga0466719_458870 | 3300042606 | Bacteria | 9954 |
| 55 | Ga0466729_217919 | 3300042621 | Bacteria | 2923 |
| 56 | Ga0466703_090005 | 3300042636 | Bacteria | 12777 |
| 57 | Ga0466703_153093 | 3300042636 | Bacteria | 4642 |
| 58 | Ga0466703_220950 | 3300042636 | Bacteria | 6933 |
| 59 | Ga0466708_221362 | 3300042652 | Bacteria | 47644 |
| 60 | Ga0466708_365429 | 3300042652 | Bacteria | 22126 |
| 61 | Ga0466711_453726 | 3300042615 | Bacteria | 14711 |
| 62 | Ga0466718_046674 | 3300042617 | Bacteria | 2787 |
| 63 | Ga0466718_110617 | 3300042617 | Bacteria | 4047 |
| 64 | Ga0466718_159847 | 3300042617 | Bacteria | 9457 |
| 65 | Ga0466723_083269 | 3300042618 | Bacteria | 4704 |
| 66 | Ga0466723_138637 | 3300042618 | Bacteria | 6893 |
| 67 | Ga0466723_293847 | 3300042618 | Bacteria | 4978 |
| 68 | Ga0466705_077477 | 3300042612 | Bacteria | 8618 |
| 69 | Ga0466705_326512 | 3300042612 | Bacteria | 3747 |
| 70 | Ga0466732_457128 | 3300042656 | Bacteria | 1949 |
| 71 | Ga0466733_180085 | 3300042659 | Bacteria | 4105 |
| 72 | Ga0466690_013799 | 3300042590 | Bacteria | 19301 |
| 73 | Ga0466690_172034 | 3300042590 | Bacteria | 4024 |
| 74 | Ga0466692_024535 | 3300042591 | Bacteria | 7061 |
| 75 | Ga0466691_166946 | 3300042593 | Bacteria | 4596 |
| 76 | Ga0466691_213789 | 3300042593 | Bacteria | 8760 |
| 77 | Ga0466695_003198 | 3300042595 | Bacteria | 7608 |
| 78 | Ga0466696_160729 | 3300042596 | Bacteria | 14370 |
| 79 | Ga0466696_187080 | 3300042596 | Bacteria | 7816 |
| 80 | JGI24695J34938_10000187 | 3300002450 | Bacteria | 58138 |
| 81 | JGI24695J34938_10000417 | 3300002450 | Bacteria | 41418 |
| 82 | JGI24695J34938_10001047 | 3300002450 | Bacteria | 25078 |
| 83 | JGI24695J34938_10004896 | 3300002450 | Bacteria | 8575 |
| 84 | JGI24695J34938_10010577 | 3300002450 | Bacteria | 5039 |
| 85 | JGI24695J34938_10015722 | 3300002450 | Unclassified | 3873 |
| 86 | JGI24695J34938_10033599 | 3300002450 | Bacteria | 2358 |
| 87 | Ga0074263_113060 | 3300005485 | Bacteria | 3262 |
| 88 | Ga0123353_10238322 | 3300010167 | Bacteria | 2829 |
| 89 | Ga0123353_10295834 | 3300010167 | Bacteria | 2475 |
| 90 | Ga0466700_353728 | 3300042600 | Bacteria | 36180 |
| 91 | Ga0466716_418608 | 3300042605 | Bacteria | 10923 |
| 92 | Ga0466719_042529 | 3300042606 | Unclassified | 3641 |
| 93 | Ga0466719_091645 | 3300042606 | Bacteria | 19245 |
| 94 | Ga0466720_115455 | 3300042607 | Bacteria | 2271 |
| 95 | Ga0466722_126039 | 3300042609 | Bacteria | 3680 |
| 96 | Ga0466722_185774 | 3300042609 | Bacteria | 3665 |
| 97 | Ga0466735_072408 | 3300042624 | Bacteria | 3959 |
| 98 | Ga0466735_150678 | 3300042624 | Bacteria | 10902 |
| 99 | Ga0466703_049030 | 3300042636 | Bacteria | 13854 |
| 100 | Ga0466704_036291 | 3300042643 | Bacteria | 8358 |
| 101 | Ga0466709_091351 | 3300042648 | Bacteria | 13086 |
| 102 | Ga0466709_223995 | 3300042648 | Bacteria | 21835 |
| 103 | Ga0466709_228985 | 3300042648 | Bacteria | 10724 |
| 104 | Ga0466708_284513 | 3300042652 | Bacteria | 7727 |
| 105 | Ga0466715_197325 | 3300042616 | Bacteria | 41893 |
| 106 | Ga0466723_146674 | 3300042618 | Bacteria | 52032 |
| 107 | Ga0466723_171803 | 3300042618 | Bacteria | 59143 |
| 108 | Ga0466723_178668 | 3300042618 | Bacteria | 30352 |
| 109 | Ga0466726_023415 | 3300042619 | Bacteria | 4729 |
| 110 | Ga0466728_091760 | 3300042620 | Bacteria | 8080 |
| 111 | Ga0466705_037563 | 3300042612 | Bacteria | 14225 |
| 112 | Ga0466705_061650 | 3300042612 | Bacteria | 6567 |
| 113 | Ga0466705_383215 | 3300042612 | Bacteria | 2947 |
| 114 | Ga0466732_002615 | 3300042656 | Bacteria | 9515 |
| 115 | Ga0466732_446997 | 3300042656 | Bacteria | 3367 |
| 116 | Ga0466733_165210 | 3300042659 | Bacteria | 6994 |
| 117 | Ga0466691_132996 | 3300042593 | Bacteria | 31181 |
| 118 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 119 | Ga0466696_166297 | 3300042596 | Bacteria | 5617 |
| 120 | Ga0466696_381753 | 3300042596 | Unclassified | 4168 |
| 121 | Nasutiter_Contig02452 | 2030936001 | Bacteria | 5234 |
| 122 | JGI24698J34947_10002466 | 3300002449 | Bacteria | 9984 |
| 123 | JGI24695J34938_10004411 | 3300002450 | Bacteria | 9250 |
| 124 | JGI24702J35022_10007473 | 3300002462 | Bacteria | 6263 |
| 125 | Ga0074263_117467 | 3300005485 | Bacteria | 2486 |
| 126 | Ga0074263_118141 | 3300005485 | Bacteria | 2034 |
| 127 | Ga0123356_10000688 | 3300010049 | Bacteria | 37446 |
| 128 | Ga0123356_10044226 | 3300010049 | Bacteria | 4145 |
| 129 | Ga0466707_075226 | 3300042601 | Bacteria | 9455 |
| 130 | Ga0466707_373219 | 3300042601 | Bacteria | 2860 |
| 131 | Ga0466716_057404 | 3300042605 | Bacteria | 13927 |
| 132 | Ga0466722_052891 | 3300042609 | Bacteria | 4566 |
| 133 | Ga0466722_149164 | 3300042609 | Bacteria | 3773 |
| 134 | Ga0466703_087827 | 3300042636 | Bacteria | 7563 |
| 135 | Ga0466703_126568 | 3300042636 | Bacteria | 23431 |
| 136 | Ga0466703_313272 | 3300042636 | Bacteria | 8707 |
| 137 | Ga0466704_137630 | 3300042643 | Bacteria | 36327 |
| 138 | Ga0466704_260196 | 3300042643 | Unclassified | 6671 |
| 139 | Ga0466711_488710 | 3300042615 | Bacteria | 35901 |
| 140 | Ga0466718_082542 | 3300042617 | Bacteria | 7886 |
| 141 | Ga0466726_008424 | 3300042619 | Bacteria | 8456 |
| 142 | Ga0466732_070748 | 3300042656 | Bacteria | 17433 |
| 143 | Ga0466690_005713 | 3300042590 | Bacteria | 4092 |
| 144 | Ga0466690_240404 | 3300042590 | Unclassified | 1778 |
| 145 | Ga0466691_137301 | 3300042593 | Bacteria | 6854 |
| 146 | Ga0466696_017564 | 3300042596 | Bacteria | 33026 |
| 147 | Ga0466696_309382 | 3300042596 | Bacteria | 27372 |
| 148 | Ga0466696_319503 | 3300042596 | Bacteria | 7683 |
| 149 | Ga0466696_472897 | 3300042596 | Bacteria | 2813 |
| 150 | JGI24698J34947_10042849 | 3300002449 | Bacteria | 2323 |
| 151 | JGI24695J34938_10000655 | 3300002450 | Bacteria | 32953 |
| 152 | JGI24695J34938_10004502 | 3300002450 | Bacteria | 9116 |
| 153 | JGI24695J34938_10005383 | 3300002450 | Bacteria | 7992 |
| 154 | Ga0123355_10087935 | 3300009826 | Bacteria | 4937 |
| 155 | Ga0123355_10181765 | 3300009826 | Bacteria | 3120 |
| 156 | Ga0123356_10000626 | 3300010049 | Bacteria | 39002 |
| 157 | Ga0123356_10005588 | 3300010049 | Bacteria | 12789 |
| 158 | Ga0123356_10009741 | 3300010049 | Bacteria | 9472 |
| 159 | Ga0123353_10000765 | 3300010167 | Bacteria | 39061 |
| 160 | Ga0466713_130166 | 3300042602 | Bacteria | 21170 |
| 161 | Ga0466719_510328 | 3300042606 | Bacteria | 2988 |
| 162 | Ga0466722_026273 | 3300042609 | Unclassified | 4231 |
| 163 | Ga0466731_004720 | 3300042622 | Bacteria | 3488 |
| 164 | Ga0466703_372386 | 3300042636 | Bacteria | 4826 |
| 165 | Ga0466704_099679 | 3300042643 | Bacteria | 21380 |
| 166 | Ga0466727_081447 | 3300042655 | Bacteria | 3854 |
| 167 | Ga0466712_109666 | 3300042614 | Bacteria | 13569 |
| 168 | Ga0466711_101269 | 3300042615 | Bacteria | 28356 |
| 169 | Ga0466711_199286 | 3300042615 | Bacteria | 13152 |
| 170 | Ga0466715_162526 | 3300042616 | Bacteria | 4260 |
| 171 | Ga0466726_117925 | 3300042619 | Bacteria | 4666 |
| 172 | Ga0466728_084124 | 3300042620 | Bacteria | 4239 |
| 173 | Ga0466732_020469 | 3300042656 | Unclassified | 13074 |
| 174 | Ga0466690_012909 | 3300042590 | Unclassified | 2658 |
| 175 | Ga0466690_033896 | 3300042590 | Bacteria | 13751 |
| 176 | Ga0466690_207376 | 3300042590 | Bacteria | 22019 |
| 177 | Ga0466693_348041 | 3300042592 | Bacteria | 4362 |
| 178 | Ga0466693_381378 | 3300042592 | Bacteria | 32518 |
| 179 | Ga0466691_026091 | 3300042593 | Bacteria | 13981 |
| 180 | Ga0466691_035534 | 3300042593 | Bacteria | 9625 |
| 181 | Ga0466694_007460 | 3300042594 | Bacteria | 11874 |
| 182 | Ga0466694_267310 | 3300042594 | Bacteria | 4581 |
| 183 | Ga0466696_247038 | 3300042596 | Bacteria | 5316 |
| 184 | 2230969671 | 2228664004 | Bacteria | 5350 |
| 185 | AustNasuHG_c1003452 | 3300000089 | Bacteria | 5706 |
| 186 | AustNasuHG_c1016956 | 3300000089 | Bacteria | 2430 |
| 187 | JGI24698J34947_10000771 | 3300002449 | Bacteria | 15860 |
| 188 | JGI24698J34947_10011365 | 3300002449 | Bacteria | 4888 |
| 189 | JGI24696J40584_12955785 | 3300002834 | Bacteria | 2924 |
| 190 | Ga0123356_10003143 | 3300010049 | Bacteria | 17393 |
| 191 | Ga0123356_10021724 | 3300010049 | Bacteria | 6058 |
| 192 | Ga0123353_10002642 | 3300010167 | Unclassified | 22317 |
| 193 | Ga0466719_051990 | 3300042606 | Bacteria | 42283 |
| 194 | Ga0466720_132002 | 3300042607 | Bacteria | 24812 |
| 195 | Ga0466731_387459 | 3300042622 | Bacteria | 3192 |
| 196 | Ga0466704_225631 | 3300042643 | Bacteria | 15716 |
| 197 | Ga0466709_158919 | 3300042648 | Unclassified | 2363 |
| 198 | Ga0466709_361009 | 3300042648 | Bacteria | 7850 |
| 199 | Ga0466708_045751 | 3300042652 | Bacteria | 23734 |
| 200 | Ga0466712_014146 | 3300042614 | Unclassified | 6469 |
| 201 | Ga0466712_028790 | 3300042614 | Bacteria | 127971 |
| 202 | Ga0466712_064008 | 3300042614 | Bacteria | 7801 |
| 203 | Ga0466715_005880 | 3300042616 | Bacteria | 11587 |
| 204 | Ga0466718_024751 | 3300042617 | Bacteria | 12817 |
| 205 | Ga0466723_314537 | 3300042618 | Bacteria | 11595 |
| 206 | Ga0466726_491287 | 3300042619 | Bacteria | 3126 |
| 207 | Ga0466728_206862 | 3300042620 | Bacteria | 5880 |
| 208 | Ga0466705_013581 | 3300042612 | Unclassified | 14563 |
| 209 | Ga0466732_069626 | 3300042656 | Bacteria | 14652 |
| 210 | Ga0466733_072637 | 3300042659 | Bacteria | 3444 |
| 211 | Ga0264413_111425 | 3300024493 | Bacteria | 62805 |
| 212 | Ga0466690_262330 | 3300042590 | Bacteria | 3315 |
| 213 | Ga0466692_197296 | 3300042591 | Bacteria | 8489 |
| 214 | Ga0466691_058612 | 3300042593 | Bacteria | 167737 |
| 215 | Ga0466694_032175 | 3300042594 | Bacteria | 7560 |
| 216 | Ga0466694_080897 | 3300042594 | Bacteria | 2808 |
| 217 | Ga0466694_141622 | 3300042594 | Bacteria | 6503 |
| 218 | Ga0466696_170818 | 3300042596 | Bacteria | 13377 |
| 219 | AustNasuHG_c1000457 | 3300000089 | Bacteria | 14334 |
| 220 | JGI24695J34938_10000013 | 3300002450 | Bacteria | 122387 |
| 221 | JGI24695J34938_10002570 | 3300002450 | Bacteria | 13685 |
| 222 | JGI24695J34938_10015728 | 3300002450 | Bacteria | 3873 |
| 223 | JGI24702J35022_10007956 | 3300002462 | Bacteria | 6035 |
| 224 | JGI24700J35501_10930666 | 3300002508 | Bacteria | 18268 |
| 225 | Ga0123355_10000674 | 3300009826 | Bacteria | 46393 |
| 226 | Ga0123356_10000555 | 3300010049 | Bacteria | 41433 |
| 227 | Ga0123356_10000810 | 3300010049 | Bacteria | 34730 |
| 228 | Ga0123353_10016793 | 3300010167 | Bacteria | 10719 |
| 229 | Ga0123353_10141152 | 3300010167 | Bacteria | 3858 |
| 230 | Ga0123353_10179701 | 3300010167 | Bacteria | 3351 |
| 231 | Ga0466713_080760 | 3300042602 | Bacteria | 28332 |
| 232 | Ga0466716_014085 | 3300042605 | Bacteria | 12433 |
| 233 | Ga0466722_006221 | 3300042609 | Bacteria | 3173 |
| 234 | Ga0466722_081538 | 3300042609 | Bacteria | 2851 |
| 235 | Ga0466722_228134 | 3300042609 | Bacteria | 13051 |
| 236 | Ga0466734_152908 | 3300042623 | Bacteria | 4087 |
| 237 | Ga0466702_465483 | 3300042635 | Bacteria | 7908 |
| 238 | Ga0466704_166784 | 3300042643 | Bacteria | 45771 |
| 239 | Ga0466708_007017 | 3300042652 | Bacteria | 7167 |
| 240 | Ga0466708_012671 | 3300042652 | Bacteria | 8745 |
| 241 | Ga0466708_131010 | 3300042652 | Bacteria | 6300 |
| 242 | Ga0466708_298681 | 3300042652 | Bacteria | 10848 |
| 243 | Ga0466727_039322 | 3300042655 | Bacteria | 4834 |
| 244 | Ga0466712_149800 | 3300042614 | Bacteria | 8389 |
| 245 | Ga0466712_160272 | 3300042614 | Bacteria | 17354 |
| 246 | Ga0466711_033997 | 3300042615 | Bacteria | 50799 |
| 247 | Ga0466711_129945 | 3300042615 | Bacteria | 4284 |
| 248 | Ga0466715_080105 | 3300042616 | Bacteria | 10394 |
| 249 | Ga0466715_505684 | 3300042616 | Bacteria | 15121 |
| 250 | Ga0466718_002928 | 3300042617 | Bacteria | 11274 |
| 251 | Ga0466718_007853 | 3300042617 | Unclassified | 2830 |
| 252 | Ga0466718_021321 | 3300042617 | Bacteria | 4394 |
| 253 | Ga0466718_049081 | 3300042617 | Bacteria | 5644 |
| 254 | Ga0466718_112813 | 3300042617 | Unclassified | 9458 |
| 255 | Ga0466723_089630 | 3300042618 | Bacteria | 9051 |
| 256 | Ga0466723_204727 | 3300042618 | Bacteria | 7673 |
| 257 | Ga0466728_111441 | 3300042620 | Bacteria | 4136 |
| 258 | Ga0466732_039838 | 3300042656 | Bacteria | 5191 |
| 259 | Ga0255809_1001811 | 3300022820 | Unclassified | 2048 |
| 260 | Ga0456237_0006008 | 3300041968 | Bacteria | 1912 |
| 261 | Ga0466690_074844 | 3300042590 | Bacteria | 7465 |
| 262 | Ga0466691_004542 | 3300042593 | Bacteria | 12558 |
| 263 | AustNasuHG_c1005097 | 3300000089 | Bacteria | 4698 |
| 264 | AustNasuHG_c1005785 | 3300000089 | Bacteria | 4415 |
| 265 | JGI24698J34947_10014381 | 3300002449 | Bacteria | 4308 |
| 266 | JGI24695J34938_10000107 | 3300002450 | Bacteria | 73579 |
| 267 | JGI24695J34938_10002716 | 3300002450 | Bacteria | 13085 |
| 268 | JGI24695J34938_10021306 | 3300002450 | Bacteria | 3172 |
| 269 | JGI24702J35022_10023790 | 3300002462 | Bacteria | 3311 |
| 270 | Ga0072940_1007423 | 3300005200 | Bacteria | 6223 |
| 271 | Ga0074263_104475 | 3300005485 | Unclassified | 5147 |
| 272 | Ga0074263_108393 | 3300005485 | Bacteria | 3215 |
| 273 | Ga0123356_10008689 | 3300010049 | Bacteria | 10073 |
| 274 | Ga0466713_080228 | 3300042602 | Bacteria | 6601 |
| 275 | Ga0466719_090501 | 3300042606 | Bacteria | 12861 |
| 276 | Ga0466719_371951 | 3300042606 | Unclassified | 2815 |
| 277 | Ga0466720_079720 | 3300042607 | Bacteria | 6747 |
| 278 | Ga0466720_081651 | 3300042607 | Bacteria | 23900 |
| 279 | Ga0466722_180546 | 3300042609 | Bacteria | 6660 |
| 280 | Ga0466703_182375 | 3300042636 | Bacteria | 9359 |
| 281 | Ga0466704_022807 | 3300042643 | Bacteria | 41664 |
| 282 | Ga0466704_496750 | 3300042643 | Bacteria | 12591 |
| 283 | Ga0466709_066451 | 3300042648 | Unclassified | 11779 |
| 284 | Ga0466715_222787 | 3300042616 | Bacteria | 9895 |
| 285 | Ga0466715_540368 | 3300042616 | Bacteria | 10720 |
| 286 | Ga0466718_159922 | 3300042617 | Bacteria | 2663 |
| 287 | Ga0466723_065526 | 3300042618 | Bacteria | 8772 |
| 288 | Ga0466726_231377 | 3300042619 | Bacteria | 8731 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10589 | NADH_4Fe-4S | NADH-ubiquinone oxidoreductase-F iron-sulfur binding region | 465 | 549 | 0.98 |
| PF01512 | Complex1_51K | Respiratory-chain NADH dehydrogenase 51 Kd subunit | 183 | 354 | 0.97 |
| PF13237 | Fer4_10 | 4Fe-4S dicluster domain | 568 | 621 | 0.96 |
| PF00037 | Fer4 | 4Fe-4S binding domain | 567 | 588 | 0.94 |
| PF13187 | Fer4_9 | 4Fe-4S dicluster domain | 572 | 624 | 0.9 |
| PF10531 | SLBB | SLBB domain | 377 | 427 | 0.88 |
| PF12838 | Fer4_7 | 4Fe-4S dicluster domain | 572 | 625 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF10589 | GO:0051539 | 4 iron, 4 sulfur cluster binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.