Protein Family IF11802

Metagenome Isolate
187 Members
49 Samples
174 Scaffolds
371.83 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125661|2781334527|
Length
414 aa
Sequence
MLIQSITAKSNNLYRQLKISLIKNGGFVFTFILLIIIYISFISLGMQDSLHGTAWPSMYYLFNVPKHYLGFLSMIGSAGTVIASVFSVHVIKRFGTRAIVILSVLLTAISLTIFSYSNSFIILCLLAIPLGLGGGSLDAALNNYVSLHYKARYMNWLHCFWGIGAFFGSLIVSSFLLYRNSWSLSYRTIGIVQFCIVILLLISLPLWDKNKSKENIVQHKTAGFKELFKIVGVKEVLLIFFCYCAIEIIAGIWGASYLVEVKGVSEDIAARWISFYYFGITSGRFISGFITMKLTNRQMIRLGQLIIGCGIITVVLPFEVCAFLGLFMIGLGCAPIFPSLLHETPNNFGKEYSHAIIGIQMGSAYIGTSIMPPIFGWLASLLSFKIFPVFIGTVLVIKIIMVGVLYRKLDKAKV

📊 Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.9%
Unclassified 29.8%
Kalotermitidae 27.7%
Rhinotermitidae 4.3%
Formicidae 2.1%
Passalidae 2.1%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 171
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
11 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
22 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
25 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
26 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
27 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
45 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_231037 3300042606 Bacteria 3725
2 Ga0466690_118857 3300042590 Bacteria 4238
3 Ga0466692_062228 3300042591 Bacteria 2102
4 Ga0466692_091931 3300042591 Unclassified 1185
5 Ga0466692_182752 3300042591 Unclassified 1282
6 Ga0466696_080358 3300042596 Bacteria 2144
7 Ga0466712_034780 3300042614 Bacteria 18932
8 Ga0466712_323757 3300042614 Bacteria 19517
9 Ga0466723_112585 3300042618 Bacteria 10756
10 Ga0466723_342250 3300042618 Bacteria 3821
11 Ga0123356_10004910 3300010049 Bacteria 13724
12 Ga0123356_10016294 3300010049 Bacteria 7097
13 Ga0123356_10039779 3300010049 Bacteria 4380
14 Ga0123356_10131714 3300010049 Bacteria 2451
15 JGI24698J34947_10011539 3300002449 Bacteria 4851
16 JGI24698J34947_10015292 3300002449 Unclassified 4178
17 JGI24695J34938_10002400 3300002450 Bacteria 14388
18 JGI24695J34938_10002480 3300002450 Bacteria 14071
19 JGI24695J34938_10004546 3300002450 Bacteria 9042
20 JGI24695J34938_10005641 3300002450 Bacteria 7738
21 Ga0072941_1041545 3300005201 Bacteria 2469
22 Ga0466705_310641 3300042612 Bacteria 2368
23 Ga0466722_010075 3300042609 Bacteria 6591
24 Ga0466694_002581 3300042594 Bacteria 9124
25 Ga0466712_117797 3300042614 Bacteria 4629
26 Ga0466712_121976 3300042614 Bacteria 3708
27 Ga0466712_322685 3300042614 Bacteria 13346
28 Ga0466718_082863 3300042617 Bacteria 8152
29 Ga0466723_070153 3300042618 Bacteria 12121
30 Ga0123356_10009968 3300010049 Bacteria 9353
31 Ga0123356_10410246 3300010049 Bacteria 1494
32 Ga0123356_10413996 3300010049 Unclassified 1488
33 Ga0466704_059562 3300042643 Bacteria 9676
34 Ga0466709_393352 3300042648 Bacteria 11386
35 Ga0466708_091605 3300042652 Bacteria 2754
36 JGI24698J34947_10009589 3300002449 Bacteria 5309
37 JGI24698J34947_10009995 3300002449 Unclassified 5201
38 JGI24698J34947_10011844 3300002449 Bacteria 4790
39 JGI24698J34947_10024796 3300002449 Bacteria 3198
40 JGI24698J34947_10027318 3300002449 Bacteria 3029
41 JGI24698J34947_10040347 3300002449 Bacteria 2411
42 JGI24695J34938_10000492 3300002450 Bacteria 38364
43 JGI24695J34938_10011278 3300002450 Bacteria 4823
44 JGI24695J34938_10064908 3300002450 Bacteria 1543
45 Ga0466700_128035 3300042600 Bacteria 3491
46 Ga0466696_013867 3300042596 Bacteria 6374
47 Ga0466712_007559 3300042614 Bacteria 17080
48 Ga0466712_141366 3300042614 Bacteria 2351
49 Ga0466712_197350 3300042614 Bacteria 26294
50 Ga0466712_219192 3300042614 Bacteria 16304
51 Ga0466712_263155 3300042614 Bacteria 1735
52 Ga0123355_10006487 3300009826 Bacteria 17348
53 Ga0123356_10198988 3300010049 Unclassified 2041
54 Ga0123356_10206130 3300010049 Bacteria 2010
55 Ga0123353_10632736 3300010167 Bacteria 1520
56 Ga0466704_554644 3300042643 Unclassified 2718
57 Ga0466709_173792 3300042648 Bacteria 5066
58 JGI24698J34947_10009054 3300002449 Bacteria 5461
59 JGI24698J34947_10010988 3300002449 Bacteria 4970
60 JGI24698J34947_10024102 3300002449 Bacteria 3251
61 JGI24698J34947_10025906 3300002449 Bacteria 3118
62 JGI24698J34947_10041413 3300002449 Bacteria 2372
63 JGI24695J34938_10000071 3300002450 Bacteria 85834
64 JGI24695J34938_10005924 3300002450 Bacteria 7490
65 Ga0068305_10035161 3300005083 Bacteria 2043
66 Ga0072941_1019670 3300005201 Bacteria 2574
67 Ga0102740_1000211 3300007140 Bacteria 22283
68 Ga0466719_567728 3300042606 Bacteria 1506
69 Ga0466693_075896 3300042592 Bacteria 53125
70 Ga0466693_385492 3300042592 Bacteria 12626
71 Ga0466696_073193 3300042596 Bacteria 34478
72 Ga0466712_076446 3300042614 Bacteria 4445
73 Ga0466712_093297 3300042614 Bacteria 3400
74 Ga0466712_210026 3300042614 Bacteria 5688
75 Ga0466715_249658 3300042616 Bacteria 4012
76 Ga0123356_10021593 3300010049 Bacteria 6076
77 Ga0123356_10033817 3300010049 Bacteria 4781
78 AustNasuHG_c1014704 3300000089 Unclassified 2653
79 JGI24698J34947_10032055 3300002449 Bacteria 2761
80 JGI24698J34947_10072579 3300002449 Bacteria 1647
81 JGI24695J34938_10000975 3300002450 Bacteria 26067
82 Ga0466713_096119 3300042602 Bacteria 9359
83 Ga0466716_262305 3300042605 Unclassified 1721
84 Ga0466722_115535 3300042609 Bacteria 2792
85 Ga0466722_161641 3300042609 Bacteria 17434
86 Ga0415639_045919 3300038395 Bacteria 1681
87 Ga0466693_445196 3300042592 Unclassified 6701
88 Ga0466696_137372 3300042596 Bacteria 16678
89 Ga0466712_079053 3300042614 Bacteria 9810
90 Ga0466712_199027 3300042614 Bacteria 1958
91 Ga0466723_091898 3300042618 Bacteria 26162
92 Ga0466708_009067 3300042652 Bacteria 4085
93 Ga0466708_182665 3300042652 Bacteria 1789
94 JGI24698J34947_10006687 3300002449 Unclassified 6332
95 JGI24698J34947_10069918 3300002449 Unclassified 1692
96 JGI24695J34938_10002476 3300002450 Bacteria 14085
97 JGI24695J34938_10019968 3300002450 Bacteria 3307
98 JGI24703J35330_11748623 3300002501 Bacteria 22536
99 Ga0072941_1069753 3300005201 Bacteria 1651
100 Ga0466733_033232 3300042659 Bacteria 22493
101 Ga0466706_192928 3300042599 Bacteria 2064
102 Ga0466720_225701 3300042607 Bacteria 8658
103 Ga0264413_122032 3300024493 Bacteria 1444
104 Ga0415639_042209 3300038395 Bacteria 33103
105 Ga0415639_077164 3300038395 Bacteria 3232
106 Ga0466692_082031 3300042591 Bacteria 5623
107 Ga0466693_086010 3300042592 Bacteria 1788
108 Ga0466691_182623 3300042593 Bacteria 3802
109 Ga0466694_140816 3300042594 Bacteria 10857
110 Ga0466712_302388 3300042614 Bacteria 2056
111 Ga0466712_318937 3300042614 Bacteria 10919
112 Ga0466715_183733 3300042616 Bacteria 42572
113 Ga0466723_066262 3300042618 Bacteria 3411
114 Ga0466723_257208 3300042618 Bacteria 3741
115 Ga0466723_312465 3300042618 Bacteria 2274
116 Ga0123356_10000599 3300010049 Bacteria 39960
117 IMNBL1DRAFT_c0003346 3300000062 Unclassified 10402
118 AustNasuHG_c1005055 3300000089 Bacteria 4719
119 JGI24698J34947_10002658 3300002449 Bacteria 9636
120 JGI24698J34947_10003152 3300002449 Bacteria 8922
121 JGI24698J34947_10026962 3300002449 Unclassified 3050
122 JGI24698J34947_10028153 3300002449 Bacteria 2977
123 JGI24698J34947_10035358 3300002449 Bacteria 2608
124 JGI24698J34947_10047805 3300002449 Bacteria 2170
125 JGI24698J34947_10064164 3300002449 Bacteria 1797
126 JGI24698J34947_10065880 3300002449 Bacteria 1765
127 JGI24695J34938_10005292 3300002450 Bacteria 8098
128 JGI24695J34938_10012044 3300002450 Bacteria 4610
129 JGI24695J34938_10013437 3300002450 Bacteria 4301
130 JGI24695J34938_10050747 3300002450 Bacteria 1818
131 Ga0466700_079560 3300042600 Bacteria 13696
132 Ga0466712_015336 3300042614 Bacteria 28683
133 Ga0466712_022483 3300042614 Bacteria 12558
134 Ga0466712_168014 3300042614 Bacteria 14787
135 Ga0466712_302659 3300042614 Bacteria 7093
136 Ga0466715_005568 3300042616 Bacteria 1899
137 Ga0466715_154965 3300042616 Unclassified 7436
138 Ga0466723_116089 3300042618 Bacteria 1531
139 Ga0466728_176072 3300042620 Bacteria 20098
140 Ga0123356_10001080 3300010049 Bacteria 30215
141 Ga0123356_10013047 3300010049 Bacteria 8038
142 Ga0466704_110831 3300042643 Bacteria 10720
143 Ga0466708_218025 3300042652 Bacteria 18464
144 JGI24698J34947_10000279 3300002449 Bacteria 21986
145 JGI24698J34947_10001309 3300002449 Bacteria 13066
146 JGI24698J34947_10009007 3300002449 Bacteria 5472
147 JGI24698J34947_10015858 3300002449 Bacteria 4097
148 JGI24695J34938_10002655 3300002450 Bacteria 13337
149 JGI24695J34938_10004532 3300002450 Bacteria 9070
150 JGI24695J34938_10011766 3300002450 Bacteria 4692
151 Ga0072941_1006765 3300005201 Bacteria 5475
152 Ga0466733_072759 3300042659 Bacteria 51080
153 Ga0466720_156869 3300042607 Bacteria 9284
154 Ga0415639_004191 3300038395 Bacteria 37294
155 Ga0415639_012135 3300038395 Bacteria 5945
156 Ga0466690_054816 3300042590 Bacteria 4193
157 Ga0466690_168514 3300042590 Bacteria 2887
158 Ga0466690_236632 3300042590 Unclassified 1721
159 Ga0466691_218708 3300042593 Bacteria 10287
160 Ga0466712_039633 3300042614 Bacteria 8876
161 Ga0466712_086270 3300042614 Bacteria 15074
162 Ga0466712_112999 3300042614 Bacteria 56841
163 Ga0466712_262457 3300042614 Bacteria 1719
164 Ga0123356_10039645 3300010049 Bacteria 4388
165 Ga0466703_179146 3300042636 Bacteria 3821
166 Ga0466703_226207 3300042636 Bacteria 3181
167 Ga0466703_243091 3300042636 Bacteria 44870
168 Ga0466708_036284 3300042652 Bacteria 35103
169 JGI24698J34947_10001883 3300002449 Bacteria 11189
170 JGI24698J34947_10003505 3300002449 Bacteria 8524
171 JGI24698J34947_10007717 3300002449 Bacteria 5911
172 JGI24695J34938_10000579 3300002450 Bacteria 35323
173 Ga0072941_1006763 3300005201 Bacteria 2506
174 Ga0072941_1016869 3300005201 Bacteria 1677

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07690 MFS_1 Major Facilitator Superfamily 273 408 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.