Protein Family IF11783
Metagenome
Metatranscriptome
Isolate
162
Members
61
Samples
149
Scaffolds
192.49
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125653|2781313508|
- Length
- 232 aa
- Sequence
- MRFFCAAFCEALCAAFLRRFLRHNLVLCQIMGDIMAKKVIVLLAEGFEEVEAITPIDYLRRAGIEVTVAAVGRENLLVKGSHGIQAAADAALRALAAEKKLVPEAWDAAVVPGGLPGADNLAACAETGAFLAAMNNAGKLVCSICASPVRVLAPLGLLAGKNFTCYPGQENFLDVNAFSPGAELRHDRVVIDGNIITSQGAGTAGEFALAIVAELAGKADAQKLAENLLLTA
Sample Types
Isolate
8.0%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.4%
Unclassified
23.7%
Kalotermitidae
22.0%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Hodotermitidae
1.7%
Taxonomy
Archaea
2
Bacteria
156
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 26 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 27 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 36 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 37 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 47 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 57 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 58 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 59 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_453616 | 3300042656 | Bacteria | 1972 |
| 2 | Ga0466694_119180 | 3300042594 | Bacteria | 20530 |
| 3 | Ga0466694_192541 | 3300042594 | Bacteria | 5813 |
| 4 | Ga0466699_247800 | 3300042597 | Bacteria | 57069 |
| 5 | Nasutiter_Contig41286 | 2030936001 | Bacteria | 2772 |
| 6 | JGI24698J34947_10004202 | 3300002449 | Unclassified | 7830 |
| 7 | JGI24698J34947_10050221 | 3300002449 | Bacteria | 2104 |
| 8 | JGI24698J34947_10114848 | 3300002449 | Bacteria | 1180 |
| 9 | Ga0072941_1017388 | 3300005201 | Bacteria | 7203 |
| 10 | Ga0466703_156718 | 3300042636 | Bacteria | 15836 |
| 11 | Ga0466706_102113 | 3300042599 | Bacteria | 2162 |
| 12 | Ga0466698_467638 | 3300042610 | Bacteria | 2371 |
| 13 | Ga0466712_048664 | 3300042614 | Bacteria | 14036 |
| 14 | Ga0466712_166813 | 3300042614 | Bacteria | 1400 |
| 15 | Ga0466723_145094 | 3300042618 | Bacteria | 12073 |
| 16 | Ga0123356_11390266 | 3300010049 | Bacteria | 863 |
| 17 | Ga0123356_11612524 | 3300010049 | Bacteria | 803 |
| 18 | Ga0415639_131240 | 3300038395 | Bacteria | 1253 |
| 19 | Ga0466693_104615 | 3300042592 | Bacteria | 4344 |
| 20 | Ga0466696_266448 | 3300042596 | Bacteria | 23351 |
| 21 | Ga0466699_190791 | 3300042597 | Archaea | 1772 |
| 22 | JGI24698J34947_10032236 | 3300002449 | Unclassified | 2752 |
| 23 | JGI24698J34947_10037560 | 3300002449 | Bacteria | 2515 |
| 24 | JGI24698J34947_10062107 | 3300002449 | Archaea | 1836 |
| 25 | JGI24698J34947_10062533 | 3300002449 | Unclassified | 1828 |
| 26 | JGI24695J34938_10141764 | 3300002450 | Bacteria | 982 |
| 27 | Ga0072941_1004358 | 3300005201 | Bacteria | 6408 |
| 28 | Ga0466708_198335 | 3300042652 | Bacteria | 35517 |
| 29 | Ga0466717_278729 | 3300042604 | Bacteria | 2522 |
| 30 | Ga0466698_313831 | 3300042610 | Bacteria | 1031 |
| 31 | Ga0466715_077616 | 3300042616 | Bacteria | 19909 |
| 32 | Ga0466726_121236 | 3300042619 | Bacteria | 2079 |
| 33 | Ga0466726_179431 | 3300042619 | Bacteria | 1326 |
| 34 | Ga0466726_210360 | 3300042619 | Bacteria | 1387 |
| 35 | Ga0123356_11406890 | 3300010049 | Bacteria | 858 |
| 36 | Ga0123356_12125172 | 3300010049 | Bacteria | 701 |
| 37 | JGI24698J34947_10031897 | 3300002449 | Bacteria | 2769 |
| 38 | Ga0466702_308241 | 3300042635 | Bacteria | 3240 |
| 39 | Ga0466709_339031 | 3300042648 | Bacteria | 11060 |
| 40 | Ga0466727_094772 | 3300042655 | Bacteria | 1441 |
| 41 | Ga0466718_019051 | 3300042617 | Bacteria | 4653 |
| 42 | Ga0123356_10028638 | 3300010049 | Bacteria | 5218 |
| 43 | Ga0123356_10358215 | 3300010049 | Bacteria | 1585 |
| 44 | Ga0123354_10301228 | 3300010882 | Bacteria | 1516 |
| 45 | Ga0223687_110562 | 3300021217 | Bacteria | 1935 |
| 46 | Ga0456237_0003499 | 3300041968 | Bacteria | 2541 |
| 47 | Ga0466690_306265 | 3300042590 | Bacteria | 5034 |
| 48 | Ga0466694_293819 | 3300042594 | Bacteria | 2222 |
| 49 | Ga0466696_403332 | 3300042596 | Bacteria | 9497 |
| 50 | Ga0466699_165609 | 3300042597 | Bacteria | 1599 |
| 51 | Ga0466699_323768 | 3300042597 | Bacteria | 7106 |
| 52 | JGI24695J34938_10051901 | 3300002450 | Bacteria | 1791 |
| 53 | Ga0072940_1033529 | 3300005200 | Bacteria | 2958 |
| 54 | Ga0466735_067354 | 3300042624 | Bacteria | 2494 |
| 55 | Ga0466735_235485 | 3300042624 | Bacteria | 2128 |
| 56 | Ga0466702_182599 | 3300042635 | Bacteria | 1937 |
| 57 | Ga0466702_197274 | 3300042635 | Bacteria | 20713 |
| 58 | Ga0466709_388827 | 3300042648 | Bacteria | 4400 |
| 59 | Ga0466708_037175 | 3300042652 | Bacteria | 5463 |
| 60 | Ga0466727_097969 | 3300042655 | Unclassified | 1535 |
| 61 | Ga0466727_241893 | 3300042655 | Bacteria | 1523 |
| 62 | Ga0466713_079769 | 3300042602 | Bacteria | 4958 |
| 63 | Ga0466720_144388 | 3300042607 | Bacteria | 27732 |
| 64 | Ga0466712_216615 | 3300042614 | Bacteria | 4584 |
| 65 | Ga0123357_10228475 | 3300009784 | Bacteria | 2046 |
| 66 | Ga0123356_10001527 | 3300010049 | Bacteria | 25484 |
| 67 | Ga0123356_10488787 | 3300010049 | Bacteria | 1385 |
| 68 | Ga0123356_11043153 | 3300010049 | Bacteria | 987 |
| 69 | Ga0123356_11073003 | 3300010049 | Bacteria | 974 |
| 70 | Ga0123353_10846801 | 3300010167 | Bacteria | 1254 |
| 71 | Ga0466699_001831 | 3300042597 | Bacteria | 1001 |
| 72 | Ga0466699_134345 | 3300042597 | Bacteria | 2023 |
| 73 | JGI24698J34947_10020084 | 3300002449 | Bacteria | 3601 |
| 74 | JGI24698J34947_10136812 | 3300002449 | Bacteria | 1038 |
| 75 | Ga0466708_398410 | 3300042652 | Bacteria | 6026 |
| 76 | Ga0466719_500015 | 3300042606 | Bacteria | 3267 |
| 77 | Ga0466722_054140 | 3300042609 | Bacteria | 10183 |
| 78 | Ga0466712_055008 | 3300042614 | Bacteria | 8717 |
| 79 | Ga0466711_012004 | 3300042615 | Bacteria | 25076 |
| 80 | Ga0466726_114019 | 3300042619 | Bacteria | 7755 |
| 81 | Ga0466726_335537 | 3300042619 | Bacteria | 1917 |
| 82 | Ga0466726_347275 | 3300042619 | Bacteria | 3629 |
| 83 | Ga0123355_10009527 | 3300009826 | Bacteria | 14786 |
| 84 | Ga0123355_10058864 | 3300009826 | Bacteria | 6213 |
| 85 | Ga0466732_396880 | 3300042656 | Bacteria | 3728 |
| 86 | Ga0466690_050782 | 3300042590 | Bacteria | 6610 |
| 87 | Ga0466699_287796 | 3300042597 | Bacteria | 1542 |
| 88 | JGI24698J34947_10032799 | 3300002449 | Bacteria | 2725 |
| 89 | JGI24698J34947_10185163 | 3300002449 | Bacteria | 829 |
| 90 | JGI24695J34938_10005411 | 3300002450 | Bacteria | 7972 |
| 91 | JGI24702J35022_10005746 | 3300002462 | Bacteria | 7231 |
| 92 | Ga0466731_234921 | 3300042622 | Bacteria | 1347 |
| 93 | Ga0466704_243319 | 3300042643 | Bacteria | 3025 |
| 94 | Ga0466727_268446 | 3300042655 | Bacteria | 9349 |
| 95 | Ga0466722_005079 | 3300042609 | Bacteria | 9676 |
| 96 | Ga0466712_056066 | 3300042614 | Bacteria | 7248 |
| 97 | Ga0466712_096564 | 3300042614 | Bacteria | 6749 |
| 98 | Ga0466712_141558 | 3300042614 | Bacteria | 4531 |
| 99 | Ga0466723_219912 | 3300042618 | Bacteria | 9179 |
| 100 | Ga0466728_036800 | 3300042620 | Bacteria | 1215 |
| 101 | Ga0123356_10000669 | 3300010049 | Bacteria | 37873 |
| 102 | Ga0123356_10007004 | 3300010049 | Bacteria | 11319 |
| 103 | Ga0123356_10134817 | 3300010049 | Bacteria | 2425 |
| 104 | Ga0123356_10143775 | 3300010049 | Bacteria | 2357 |
| 105 | Ga0123356_11183595 | 3300010049 | Bacteria | 931 |
| 106 | Ga0466705_336088 | 3300042612 | Bacteria | 22942 |
| 107 | Ga0264413_108282 | 3300024493 | Bacteria | 7505 |
| 108 | Ga0466692_096937 | 3300042591 | Bacteria | 5535 |
| 109 | Ga0466692_147303 | 3300042591 | Bacteria | 1219 |
| 110 | AustNasuHG_c1006793 | 3300000089 | Bacteria | 4077 |
| 111 | JGI24698J34947_10021215 | 3300002449 | Bacteria | 3496 |
| 112 | JGI24698J34947_10027794 | 3300002449 | Bacteria | 3000 |
| 113 | JGI24698J34947_10068374 | 3300002449 | Bacteria | 1718 |
| 114 | JGI24698J34947_10096444 | 3300002449 | Bacteria | 1341 |
| 115 | JGI24698J34947_10194769 | 3300002449 | Bacteria | 799 |
| 116 | Ga0072941_1020792 | 3300005201 | Bacteria | 5298 |
| 117 | Ga0072941_1037731 | 3300005201 | Bacteria | 3289 |
| 118 | Ga0466702_094944 | 3300042635 | Bacteria | 4304 |
| 119 | Ga0466702_452168 | 3300042635 | Bacteria | 15871 |
| 120 | Ga0466703_190455 | 3300042636 | Bacteria | 7330 |
| 121 | Ga0466704_200355 | 3300042643 | Bacteria | 35576 |
| 122 | Ga0466708_314115 | 3300042652 | Bacteria | 7570 |
| 123 | Ga0466708_451468 | 3300042652 | Bacteria | 26165 |
| 124 | Ga0466716_076540 | 3300042605 | Bacteria | 1420 |
| 125 | Ga0466716_179440 | 3300042605 | Bacteria | 8901 |
| 126 | Ga0466712_118636 | 3300042614 | Bacteria | 10808 |
| 127 | Ga0466712_256819 | 3300042614 | Bacteria | 2240 |
| 128 | Ga0466726_139023 | 3300042619 | Bacteria | 48573 |
| 129 | Ga0466726_161858 | 3300042619 | Bacteria | 1754 |
| 130 | Ga0123356_10019991 | 3300010049 | Bacteria | 6342 |
| 131 | Ga0123356_10027099 | 3300010049 | Bacteria | 5374 |
| 132 | Ga0466694_026904 | 3300042594 | Bacteria | 4160 |
| 133 | Ga0466699_015469 | 3300042597 | Bacteria | 3262 |
| 134 | Ga0466699_419396 | 3300042597 | Bacteria | 1614 |
| 135 | AustNasuHG_c1001231 | 3300000089 | Bacteria | 9206 |
| 136 | JGI24698J34947_10050158 | 3300002449 | Bacteria | 2106 |
| 137 | JGI24698J34947_10055926 | 3300002449 | Bacteria | 1964 |
| 138 | JGI24695J34938_10127714 | 3300002450 | Bacteria | 1036 |
| 139 | Ga0072941_1013450 | 3300005201 | Bacteria | 5141 |
| 140 | Ga0466735_174542 | 3300042624 | Bacteria | 12879 |
| 141 | Ga0466702_034864 | 3300042635 | Bacteria | 6773 |
| 142 | Ga0466702_447514 | 3300042635 | Bacteria | 1337 |
| 143 | Ga0466704_264198 | 3300042643 | Bacteria | 36997 |
| 144 | Ga0466708_098190 | 3300042652 | Bacteria | 7730 |
| 145 | Ga0466721_143465 | 3300042608 | Bacteria | 13673 |
| 146 | Ga0466721_369877 | 3300042608 | Bacteria | 1818 |
| 147 | Ga0466715_422638 | 3300042616 | Bacteria | 8966 |
| 148 | Ga0466723_124634 | 3300042618 | Bacteria | 6478 |
| 149 | Ga0123353_10665715 | 3300010167 | Bacteria | 1470 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01965 | DJ-1_PfpI | DJ-1/PfpI family | 37 | 213 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.