Protein Family IF11695
Metagenome
Isolate
187
Members
68
Samples
156
Scaffolds
125.7
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2772190889|2773431377|
- Length
- 135 aa
- Sequence
- MARVAGVDLPKNKRLDIALRYIYGIGAAISNEIIAELELDPAKRVKDLTESEVNKINNLITKNLKVEGDLRREIQSNIKRLIEIGSYRGMRHRRNLPVRGQRTKTNARTRRGKRKTVGAGKAAAPAAGGAAAKKG
Sample Types
Isolate
16.6%
Metagenome
83.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
22.4%
Kalotermitidae
19.4%
Drosophilidae
13.4%
Termitidae
13.4%
Rhinotermitidae
6.0%
Apidae
6.0%
Termopsidae
6.0%
Elmidae
4.5%
Scarabaeidae
1.5%
Penaeidae
1.5%
Passalidae
1.5%
Tenebrionidae
1.5%
Hodotermitidae
1.5%
Nephropidae
1.5%
Taxonomy
Archaea
1
Bacteria
179
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 2 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 3 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 4 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 7 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 12 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 15 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 16 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 17 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 27 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 28 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 29 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 30 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 35 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 36 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 41 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 47 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 48 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 49 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 53 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 58 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 59 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 62 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_001254 | 3300042624 | Bacteria | 21222 |
| 2 | Ga0466735_164481 | 3300042624 | Bacteria | 11213 |
| 3 | Ga0466735_218123 | 3300042624 | Bacteria | 14066 |
| 4 | Ga0466704_254590 | 3300042643 | Bacteria | 26552 |
| 5 | Ga0466727_059455 | 3300042655 | Bacteria | 175715 |
| 6 | Ga0466711_134125 | 3300042615 | Bacteria | 100014 |
| 7 | Ga0466715_402109 | 3300042616 | Bacteria | 22027 |
| 8 | Ga0466723_180228 | 3300042618 | Bacteria | 22722 |
| 9 | Ga0466728_355312 | 3300042620 | Bacteria | 41370 |
| 10 | Ga0466729_026885 | 3300042621 | Bacteria | 13644 |
| 11 | Ga0466729_049621 | 3300042621 | Bacteria | 3202 |
| 12 | Ga0466729_053906 | 3300042621 | Bacteria | 1677 |
| 13 | Ga0123356_12349655 | 3300010049 | Bacteria | 667 |
| 14 | Ga0123353_10000467 | 3300010167 | Bacteria | 50553 |
| 15 | Ga0466706_010205 | 3300042599 | Bacteria | 97987 |
| 16 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 17 | Ga0466707_063131 | 3300042601 | Bacteria | 29958 |
| 18 | Ga0466707_368827 | 3300042601 | Bacteria | 5535 |
| 19 | Ga0466713_104587 | 3300042602 | Bacteria | 60209 |
| 20 | Ga0466722_167247 | 3300042609 | Bacteria | 3850 |
| 21 | Ga0415639_027175 | 3300038395 | Bacteria | 16778 |
| 22 | Ga0466690_179624 | 3300042590 | Bacteria | 9830 |
| 23 | Ga0466735_146156 | 3300042624 | Bacteria | 2781 |
| 24 | Ga0466735_152267 | 3300042624 | Bacteria | 2188 |
| 25 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 26 | Ga0466723_051817 | 3300042618 | Bacteria | 7638 |
| 27 | Ga0466726_077377 | 3300042619 | Bacteria | 33283 |
| 28 | Ga0466726_228652 | 3300042619 | Bacteria | 2681 |
| 29 | Ga0466728_151666 | 3300042620 | Bacteria | 23701 |
| 30 | Ga0466706_144566 | 3300042599 | Bacteria | 12471 |
| 31 | Ga0466713_059288 | 3300042602 | Bacteria | 171779 |
| 32 | Ga0466716_126380 | 3300042605 | Bacteria | 28858 |
| 33 | Ga0466719_492562 | 3300042606 | Bacteria | 22587 |
| 34 | Ga0466696_029290 | 3300042596 | Bacteria | 39093 |
| 35 | IMNBGM34_c003591 | 3300000036 | Bacteria | 2131 |
| 36 | Ga0466705_208486 | 3300042612 | Bacteria | 71494 |
| 37 | Ga0466705_211457 | 3300042612 | Bacteria | 22546 |
| 38 | Ga0466735_059484 | 3300042624 | Bacteria | 12495 |
| 39 | Ga0466703_194575 | 3300042636 | Bacteria | 7445 |
| 40 | Ga0466703_220297 | 3300042636 | Bacteria | 23837 |
| 41 | Ga0466704_431343 | 3300042643 | Bacteria | 2958 |
| 42 | Ga0466723_091919 | 3300042618 | Bacteria | 27263 |
| 43 | Ga0466726_340157 | 3300042619 | Bacteria | 3882 |
| 44 | Ga0466728_411352 | 3300042620 | Bacteria | 26274 |
| 45 | Ga0466729_052551 | 3300042621 | Bacteria | 2338 |
| 46 | Ga0466729_129641 | 3300042621 | Bacteria | 24606 |
| 47 | Ga0123355_10069183 | 3300009826 | Bacteria | 5675 |
| 48 | Ga0466707_315151 | 3300042601 | Bacteria | 79442 |
| 49 | Ga0466714_088412 | 3300042603 | Bacteria | 38937 |
| 50 | Ga0466716_112946 | 3300042605 | Bacteria | 4427 |
| 51 | Ga0466719_262814 | 3300042606 | Bacteria | 3574 |
| 52 | Ga0466722_000144 | 3300042609 | Bacteria | 10208 |
| 53 | Ga0466690_029087 | 3300042590 | Bacteria | 68822 |
| 54 | Ga0466690_339067 | 3300042590 | Bacteria | 3015 |
| 55 | Ga0068302_10007384 | 3300005071 | Bacteria | 2661 |
| 56 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 57 | Ga0072941_1646735 | 3300005201 | Bacteria | 1291 |
| 58 | Ga0466705_083031 | 3300042612 | Bacteria | 54035 |
| 59 | Ga0466735_073409 | 3300042624 | Bacteria | 4128 |
| 60 | Ga0466735_201674 | 3300042624 | Bacteria | 26620 |
| 61 | Ga0466704_375208 | 3300042643 | Bacteria | 49491 |
| 62 | Ga0466727_312812 | 3300042655 | Unclassified | 1355 |
| 63 | Ga0466711_255339 | 3300042615 | Bacteria | 5269 |
| 64 | Ga0466715_256894 | 3300042616 | Bacteria | 26066 |
| 65 | Ga0466723_128569 | 3300042618 | Bacteria | 22727 |
| 66 | Ga0466726_032272 | 3300042619 | Bacteria | 1653 |
| 67 | Ga0466726_303540 | 3300042619 | Bacteria | 65545 |
| 68 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 69 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 70 | Ga0466729_117205 | 3300042621 | Bacteria | 50557 |
| 71 | Ga0466707_165389 | 3300042601 | Bacteria | 7455 |
| 72 | Ga0466713_059453 | 3300042602 | Bacteria | 25190 |
| 73 | Ga0466713_094150 | 3300042602 | Bacteria | 2198 |
| 74 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 75 | Ga0466690_107531 | 3300042590 | Bacteria | 1036 |
| 76 | Ga0466690_227494 | 3300042590 | Bacteria | 19382 |
| 77 | Ga0466735_034807 | 3300042624 | Bacteria | 1455 |
| 78 | Ga0466735_070774 | 3300042624 | Bacteria | 15100 |
| 79 | Ga0466704_102397 | 3300042643 | Unclassified | 3461 |
| 80 | Ga0466704_591830 | 3300042643 | Bacteria | 37928 |
| 81 | Ga0466727_322139 | 3300042655 | Bacteria | 101886 |
| 82 | Ga0466711_355509 | 3300042615 | Bacteria | 12832 |
| 83 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 84 | Ga0466711_376431 | 3300042615 | Bacteria | 48940 |
| 85 | Ga0466715_046636 | 3300042616 | Bacteria | 70768 |
| 86 | Ga0466715_472941 | 3300042616 | Bacteria | 17840 |
| 87 | Ga0466723_053195 | 3300042618 | Bacteria | 11447 |
| 88 | Ga0466726_320957 | 3300042619 | Bacteria | 1147 |
| 89 | Ga0123356_10421823 | 3300010049 | Bacteria | 1476 |
| 90 | Ga0466706_023727 | 3300042599 | Bacteria | 1149 |
| 91 | Ga0466700_316608 | 3300042600 | Bacteria | 72668 |
| 92 | Ga0466707_012192 | 3300042601 | Bacteria | 7479 |
| 93 | Ga0466707_413321 | 3300042601 | Bacteria | 5124 |
| 94 | Ga0466713_092327 | 3300042602 | Bacteria | 48279 |
| 95 | Ga0466722_036721 | 3300042609 | Bacteria | 2315 |
| 96 | Ga0415639_003419 | 3300038395 | Bacteria | 52955 |
| 97 | Ga0466692_138200 | 3300042591 | Bacteria | 4068 |
| 98 | Ga0466691_226264 | 3300042593 | Bacteria | 41880 |
| 99 | JGI24702J35022_10014100 | 3300002462 | Bacteria | 4416 |
| 100 | Ga0466705_365823 | 3300042612 | Bacteria | 22090 |
| 101 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 102 | Ga0466735_036591 | 3300042624 | Bacteria | 3911 |
| 103 | Ga0466704_179500 | 3300042643 | Bacteria | 16939 |
| 104 | Ga0466704_489646 | 3300042643 | Bacteria | 7305 |
| 105 | Ga0466711_316911 | 3300042615 | Bacteria | 1033 |
| 106 | Ga0466723_210101 | 3300042618 | Unclassified | 6911 |
| 107 | Ga0466729_155158 | 3300042621 | Bacteria | 5707 |
| 108 | Ga0123357_10004444 | 3300009784 | Bacteria | 16465 |
| 109 | Ga0123357_10006163 | 3300009784 | Bacteria | 14543 |
| 110 | Ga0123355_10033702 | 3300009826 | Bacteria | 8317 |
| 111 | Ga0466719_126414 | 3300042606 | Bacteria | 59815 |
| 112 | Ga0415639_011937 | 3300038395 | Unclassified | 4418 |
| 113 | Ga0466690_101976 | 3300042590 | Unclassified | 3664 |
| 114 | Ga0466735_033778 | 3300042624 | Bacteria | 18285 |
| 115 | Ga0466735_052919 | 3300042624 | Bacteria | 17118 |
| 116 | Ga0466735_068093 | 3300042624 | Bacteria | 16099 |
| 117 | Ga0466703_094842 | 3300042636 | Bacteria | 32537 |
| 118 | Ga0466709_233182 | 3300042648 | Bacteria | 91749 |
| 119 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 120 | Ga0466715_258610 | 3300042616 | Bacteria | 21204 |
| 121 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 122 | Ga0466726_020553 | 3300042619 | Bacteria | 11602 |
| 123 | Ga0466726_301743 | 3300042619 | Bacteria | 1530 |
| 124 | Ga0466726_433568 | 3300042619 | Bacteria | 3842 |
| 125 | Ga0123356_10295620 | 3300010049 | Bacteria | 1722 |
| 126 | Ga0123353_10783067 | 3300010167 | Bacteria | 1321 |
| 127 | Ga0466706_213897 | 3300042599 | Bacteria | 18237 |
| 128 | Ga0466707_221470 | 3300042601 | Bacteria | 71824 |
| 129 | Ga0466716_454581 | 3300042605 | Bacteria | 19893 |
| 130 | Ga0466719_048950 | 3300042606 | Bacteria | 50096 |
| 131 | Ga0466719_480821 | 3300042606 | Bacteria | 7291 |
| 132 | Ga0466722_074575 | 3300042609 | Bacteria | 2726 |
| 133 | Ga0466690_230957 | 3300042590 | Bacteria | 25729 |
| 134 | Ga0466690_373044 | 3300042590 | Bacteria | 1372 |
| 135 | Ga0068305_10001287 | 3300005083 | Bacteria | 40663 |
| 136 | Ga0068305_10001382 | 3300005083 | Bacteria | 35132 |
| 137 | Ga0068305_10005361 | 3300005083 | Bacteria | 24001 |
| 138 | Ga0466735_053051 | 3300042624 | Bacteria | 11352 |
| 139 | Ga0466704_375586 | 3300042643 | Bacteria | 37503 |
| 140 | Ga0466727_214209 | 3300042655 | Bacteria | 66628 |
| 141 | Ga0466711_427370 | 3300042615 | Bacteria | 90157 |
| 142 | Ga0466715_049968 | 3300042616 | Bacteria | 3336 |
| 143 | Ga0466726_172880 | 3300042619 | Bacteria | 24710 |
| 144 | Ga0466726_258671 | 3300042619 | Archaea | 1087 |
| 145 | Ga0466726_436207 | 3300042619 | Bacteria | 5154 |
| 146 | Ga0466728_236803 | 3300042620 | Unclassified | 2370 |
| 147 | Ga0123356_10195345 | 3300010049 | Bacteria | 2058 |
| 148 | Ga0466706_016612 | 3300042599 | Bacteria | 25546 |
| 149 | Ga0466706_120251 | 3300042599 | Bacteria | 11136 |
| 150 | Ga0456237_0013423 | 3300041968 | Unclassified | 1177 |
| 151 | Ga0466690_060763 | 3300042590 | Bacteria | 1202 |
| 152 | Ga0466690_262559 | 3300042590 | Bacteria | 16410 |
| 153 | Ga0466692_168593 | 3300042591 | Bacteria | 5656 |
| 154 | JGI24705J35276_12238808 | 3300002504 | Bacteria | 121301 |
| 155 | Ga0068302_10001564 | 3300005071 | Bacteria | 20938 |
| 156 | Ga0068305_10001840 | 3300005083 | Bacteria | 12768 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00416 | Ribosomal_S13 | Ribosomal protein S13/S18 | 3 | 109 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.