Protein Family IF11267
Metagenome
Isolate
127
Members
69
Samples
98
Scaffolds
211.32
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2675903497|2678199017|
- Length
- 228 aa
- Sequence
- VSTVQIKTPEGAAGGSVELPDHVFDVTANIALMHQVVTAQLNAARQGSHDTKTRGEVRGGGKKPYRQKGTGRARQGSVRAPQFAGGGTVHGPTPRDYSQRTPKKMKAAALRGALSDRARAGRVHVVSALVEGDTPSTKAARKTLEVLLPEAGASRVLVVVERTAETALLSLRNLPQVHMIAPDQLNTHDVLVNDVVVFTQTALDDFLSGPIATPKAASRRAAAEEGEK
Sample Types
Isolate
22.8%
Metagenome
77.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.9%
Formicidae
20.3%
Unclassified
17.4%
Kalotermitidae
15.9%
Blattidae
4.3%
Rhinotermitidae
4.3%
Passalidae
1.4%
Armadillidiidae
1.4%
Hodotermitidae
1.4%
Termopsidae
1.4%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 2 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 3 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 4 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 5 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 13 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 14 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 15 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 16 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 25 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 28 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 29 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 30 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 31 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 32 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 39 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 40 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 41 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 51 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 57 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 58 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 59 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 60 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 61 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 62 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 63 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 64 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 65 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 66 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 67 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 69 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_210922 | 3300042612 | Bacteria | 8379 |
| 2 | Ga0466734_061713 | 3300042623 | Bacteria | 7989 |
| 3 | Ga0466703_348284 | 3300042636 | Bacteria | 9095 |
| 4 | Ga0466704_199178 | 3300042643 | Bacteria | 10818 |
| 5 | Ga0466708_414335 | 3300042652 | Bacteria | 2887 |
| 6 | Ga0466698_217530 | 3300042610 | Bacteria | 3040 |
| 7 | Ga0466693_189648 | 3300042592 | Bacteria | 16531 |
| 8 | Ga0466705_052204 | 3300042612 | Unclassified | 1433 |
| 9 | Ga0123353_10000701 | 3300010167 | Bacteria | 40961 |
| 10 | Ga0466729_179365 | 3300042621 | Unclassified | 1167 |
| 11 | Ga0123356_10022524 | 3300010049 | Bacteria | 5947 |
| 12 | Ga0466729_318294 | 3300042621 | Bacteria | 2165 |
| 13 | Ga0466703_312372 | 3300042636 | Bacteria | 1100 |
| 14 | Ga0466708_097335 | 3300042652 | Bacteria | 43487 |
| 15 | Ga0466713_019517 | 3300042602 | Bacteria | 68401 |
| 16 | Ga0466714_074012 | 3300042603 | Bacteria | 10127 |
| 17 | Ga0466719_192219 | 3300042606 | Bacteria | 3159 |
| 18 | Ga0466705_423585 | 3300042612 | Bacteria | 1493 |
| 19 | Ga0466723_045923 | 3300042618 | Bacteria | 2017 |
| 20 | Ga0160455_105235 | 3300012837 | Bacteria | 1438 |
| 21 | Ga0415639_119257 | 3300038395 | Bacteria | 1584 |
| 22 | Ga0466696_256758 | 3300042596 | Bacteria | 1400 |
| 23 | Ga0466696_302469 | 3300042596 | Bacteria | 1730 |
| 24 | Ga0466696_386318 | 3300042596 | Bacteria | 1417 |
| 25 | Ga0072940_1390061 | 3300005200 | Bacteria | 2036 |
| 26 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 27 | Ga0466724_60490 | 3300042649 | Bacteria | 1347 |
| 28 | Ga0466708_179558 | 3300042652 | Bacteria | 2887 |
| 29 | Ga0466713_008709 | 3300042602 | Bacteria | 25958 |
| 30 | Ga0466715_118668 | 3300042616 | Bacteria | 9572 |
| 31 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 32 | Ga0466723_154795 | 3300042618 | Bacteria | 3566 |
| 33 | Ga0466728_056079 | 3300042620 | Bacteria | 1820 |
| 34 | Ga0466692_196296 | 3300042591 | Bacteria | 21527 |
| 35 | Ga0466696_092509 | 3300042596 | Bacteria | 3737 |
| 36 | Ga0466696_410938 | 3300042596 | Bacteria | 3488 |
| 37 | JGI24696J40584_12925542 | 3300002834 | Bacteria | 1401 |
| 38 | Ga0466705_123550 | 3300042612 | Bacteria | 1346 |
| 39 | Ga0123355_10027091 | 3300009826 | Bacteria | 9253 |
| 40 | Ga0123356_10915242 | 3300010049 | Bacteria | 1048 |
| 41 | Ga0466703_068182 | 3300042636 | Bacteria | 42719 |
| 42 | Ga0466704_353103 | 3300042643 | Bacteria | 17158 |
| 43 | Ga0466706_237425 | 3300042599 | Bacteria | 2106 |
| 44 | Ga0466714_146925 | 3300042603 | Bacteria | 1158 |
| 45 | Ga0466717_002338 | 3300042604 | Bacteria | 6314 |
| 46 | Ga0466717_102305 | 3300042604 | Bacteria | 35520 |
| 47 | Ga0466722_227979 | 3300042609 | Bacteria | 1882 |
| 48 | Ga0466722_252156 | 3300042609 | Bacteria | 1660 |
| 49 | Ga0466723_024418 | 3300042618 | Bacteria | 7163 |
| 50 | Ga0466726_134894 | 3300042619 | Bacteria | 3883 |
| 51 | Ga0466728_247122 | 3300042620 | Bacteria | 3880 |
| 52 | Ga0415639_009008 | 3300038395 | Bacteria | 2762 |
| 53 | Ga0466691_199512 | 3300042593 | Bacteria | 13089 |
| 54 | Ga0466696_366705 | 3300042596 | Bacteria | 1619 |
| 55 | Ga0072940_1175931 | 3300005200 | Bacteria | 1741 |
| 56 | Ga0123356_10183892 | 3300010049 | Bacteria | 2114 |
| 57 | Ga0123353_10241410 | 3300010167 | Bacteria | 2807 |
| 58 | Ga0466729_250043 | 3300042621 | Bacteria | 6259 |
| 59 | Ga0466704_031146 | 3300042643 | Bacteria | 38318 |
| 60 | Ga0466704_308500 | 3300042643 | Bacteria | 4410 |
| 61 | Ga0466708_188376 | 3300042652 | Bacteria | 3433 |
| 62 | Ga0466700_247498 | 3300042600 | Bacteria | 1520 |
| 63 | Ga0466714_167827 | 3300042603 | Bacteria | 1271 |
| 64 | Ga0466722_028120 | 3300042609 | Bacteria | 3546 |
| 65 | Ga0466722_156718 | 3300042609 | Bacteria | 3636 |
| 66 | Ga0466728_043237 | 3300042620 | Bacteria | 51050 |
| 67 | Ga0466728_082463 | 3300042620 | Bacteria | 32980 |
| 68 | Ga0415639_182586 | 3300038395 | Bacteria | 1179 |
| 69 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
| 70 | Ga0466696_108488 | 3300042596 | Bacteria | 3212 |
| 71 | JGI24705J35276_12200086 | 3300002504 | Bacteria | 1596 |
| 72 | Ga0466705_063962 | 3300042612 | Bacteria | 1286 |
| 73 | Ga0466705_122096 | 3300042612 | Unclassified | 2114 |
| 74 | Ga0466733_146788 | 3300042659 | Bacteria | 1090 |
| 75 | Ga0123357_10008408 | 3300009784 | Bacteria | 12887 |
| 76 | Ga0466704_404062 | 3300042643 | Unclassified | 1370 |
| 77 | Ga0466704_585929 | 3300042643 | Bacteria | 1618 |
| 78 | Ga0466709_229264 | 3300042648 | Bacteria | 3597 |
| 79 | Ga0466707_033064 | 3300042601 | Bacteria | 5416 |
| 80 | Ga0466707_334939 | 3300042601 | Bacteria | 1924 |
| 81 | Ga0466705_497123 | 3300042612 | Bacteria | 3161 |
| 82 | Ga0466718_054902 | 3300042617 | Bacteria | 1223 |
| 83 | Ga0466692_151313 | 3300042591 | Bacteria | 9518 |
| 84 | JGI24695J34938_10041485 | 3300002450 | Bacteria | 2066 |
| 85 | Ga0123353_11544588 | 3300010167 | Bacteria | 842 |
| 86 | Ga0466734_020692 | 3300042623 | Bacteria | 1643 |
| 87 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 88 | Ga0466707_233622 | 3300042601 | Bacteria | 11636 |
| 89 | Ga0466719_225715 | 3300042606 | Bacteria | 2938 |
| 90 | Ga0466715_211637 | 3300042616 | Bacteria | 14001 |
| 91 | Ga0466723_351679 | 3300042618 | Bacteria | 2749 |
| 92 | Ga0466728_094593 | 3300042620 | Bacteria | 2752 |
| 93 | Ga0466729_023187 | 3300042621 | Bacteria | 1945 |
| 94 | Ga0466657_232548 | 3300042582 | Bacteria | 1830 |
| 95 | Ga0466693_070193 | 3300042592 | Bacteria | 6074 |
| 96 | Ga0466694_152665 | 3300042594 | Bacteria | 1927 |
| 97 | IMNBL1DRAFT_c0035011 | 3300000062 | Bacteria | 1777 |
| 98 | Ga0123357_10003044 | 3300009784 | Bacteria | 19002 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00573 | Ribosomal_L4 | Ribosomal protein L4/L1 family | 17 | 205 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.