Protein Family IF10991
Metagenome
Isolate
374
Members
213
Samples
237
Scaffolds
133.58
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2568526170|2569119338|
- Length
- 148 aa
- Sequence
- MNRTSNQLFVTRKRGSMAAAKQAARKPRRRDRKSVPVGQAHIKSTFNNTIISITDPSGAVVAWASGGDVGFKGSRKSTPYAAGMAAESAARKAMEHGVKKVDVFVKGPGSGRETAIRSLQSAGLEVGSISDVTPQAHNGVRPPKRRRV
Sample Types
Isolate
36.6%
Metagenome
63.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.8%
Termitidae
14.6%
Apidae
8.8%
Formicidae
7.3%
Culicidae
4.9%
Kalotermitidae
4.9%
Scarabaeidae
4.4%
Anthocoridae
4.4%
Armadillidiidae
3.9%
Tenebrionidae
3.4%
Elmidae
2.0%
Hydrophilidae
1.5%
Dytiscidae
1.5%
Cicadellidae
1.5%
Cambaridae
1.0%
Cerambycidae
1.0%
Rhinotermitidae
1.0%
Pyrrhocoridae
0.5%
Termopsidae
0.5%
Cimicidae
0.5%
Reduviidae
0.5%
Chironomidae
0.5%
Thomisidae
0.5%
Hodotermitidae
0.5%
Pyralidae
0.5%
Curculionidae
0.5%
Taxonomy
Archaea
0
Bacteria
301
Eukaryota
0
Viruses
0
Unclassified
73
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 2 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 3 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 4 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 5 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 6 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 7 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 8 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 9 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 10 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 11 | 2820940989 | Unclassified Actinobacteria Emb289P1bin20 | Isolate | Unclassified |
| 12 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 13 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 14 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 15 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 16 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 17 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 18 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 19 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 20 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 23 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 24 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 25 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 28 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 31 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 32 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 33 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 34 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 35 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 36 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 37 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 38 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 39 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 40 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 41 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 42 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 43 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 44 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 47 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 48 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 49 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 58 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 59 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 60 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 61 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 62 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 63 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 64 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 65 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 66 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 67 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 68 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 69 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 70 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 71 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 74 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 75 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 76 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 77 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 78 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 79 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 80 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 81 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 82 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 83 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 84 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 85 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 86 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 87 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 88 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 89 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 90 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 91 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 92 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 93 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 94 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 95 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 96 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 97 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 98 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 99 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 100 | 638341057 | Candidatus Sulcia muelleri Hc | Isolate | Cicadellidae |
| 101 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 102 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 103 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 104 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 105 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 106 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 107 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 108 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 109 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 110 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 111 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 112 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 113 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 114 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 115 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 116 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 117 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 118 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 119 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 120 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 121 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 122 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 123 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 124 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 125 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 126 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 127 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 128 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 129 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 130 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 131 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 132 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 133 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 134 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 135 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 136 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 137 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 138 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 139 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 140 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 141 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 142 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 143 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 144 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 145 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 146 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 147 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 148 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 149 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 150 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 151 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 152 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 153 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 154 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 155 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 156 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 157 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 158 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 159 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 160 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 161 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 162 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 163 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 164 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 165 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 166 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 167 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 168 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 169 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 170 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 171 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 172 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 173 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 174 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 175 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 176 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 177 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 178 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 179 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 180 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 181 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 182 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 183 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 184 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 185 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 186 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 187 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 188 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 189 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 190 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 191 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 192 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 193 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 194 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 195 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 196 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 197 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 198 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 199 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 200 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 201 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 202 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 203 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 204 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 205 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 206 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 207 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 208 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 209 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 210 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 211 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 212 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 213 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_094685 | 3300042659 | Bacteria | 53552 |
| 2 | Ga0562378_3859 | 3300056814 | Unclassified | 7581 |
| 3 | Ga0562376_0179 | 3300056857 | Bacteria | 133712 |
| 4 | Ga0123356_10478274 | 3300010049 | Unclassified | 1398 |
| 5 | Ga0123353_10378331 | 3300010167 | Bacteria | 2119 |
| 6 | Ga0123354_10130124 | 3300010882 | Unclassified | 3185 |
| 7 | Ga0160455_117383 | 3300012837 | Unclassified | 631 |
| 8 | Ga0160472_113431 | 3300012839 | Unclassified | 926 |
| 9 | Ga0160434_101420 | 3300012850 | Unclassified | 4500 |
| 10 | Ga0466693_136620 | 3300042592 | Bacteria | 49193 |
| 11 | Ga0466696_216547 | 3300042596 | Bacteria | 1579 |
| 12 | Ga0466715_021651 | 3300042616 | Unclassified | 16316 |
| 13 | Ga0466728_437878 | 3300042620 | Bacteria | 33643 |
| 14 | Ga0466729_002760 | 3300042621 | Bacteria | 1434 |
| 15 | Ga0466729_018162 | 3300042621 | Bacteria | 6285 |
| 16 | Ga0466701_077293 | 3300042598 | Unclassified | 1445 |
| 17 | Ga0466707_302603 | 3300042601 | Bacteria | 62986 |
| 18 | Ga0466713_138744 | 3300042602 | Bacteria | 6046 |
| 19 | Ga0466714_089775 | 3300042603 | Bacteria | 5917 |
| 20 | Ga0466717_169522 | 3300042604 | Unclassified | 1910 |
| 21 | Ga0466719_485651 | 3300042606 | Bacteria | 5723 |
| 22 | Ga0466721_235909 | 3300042608 | Bacteria | 27576 |
| 23 | Ga0466698_217106 | 3300042610 | Unclassified | 1171 |
| 24 | Ga0466698_513886 | 3300042610 | Bacteria | 2787 |
| 25 | Ga0072940_1075404 | 3300005200 | Unclassified | 1468 |
| 26 | Ga0072941_1210333 | 3300005201 | Unclassified | 3875 |
| 27 | Ga0123357_10002750 | 3300009784 | Bacteria | 19825 |
| 28 | Ga0466729_278153 | 3300042621 | Bacteria | 1129 |
| 29 | Ga0466730_003828 | 3300042625 | Bacteria | 1004 |
| 30 | Ga0466697_144408 | 3300042611 | Bacteria | 1321 |
| 31 | Ga0466705_332043 | 3300042612 | Unclassified | 1120 |
| 32 | Ga0466733_021438 | 3300042659 | Bacteria | 18422 |
| 33 | Ga0466733_108382 | 3300042659 | Bacteria | 19458 |
| 34 | Ga0562378_1802 | 3300056814 | Bacteria | 21048 |
| 35 | Ga0562375_1322 | 3300056856 | Bacteria | 34684 |
| 36 | Ga0123355_10001031 | 3300009826 | Unclassified | 38599 |
| 37 | Ga0123356_10020321 | 3300010049 | Bacteria | 6285 |
| 38 | Ga0123356_10058035 | 3300010049 | Bacteria | 3609 |
| 39 | Ga0123353_10022924 | 3300010167 | Bacteria | 9434 |
| 40 | Ga0123353_10101492 | 3300010167 | Bacteria | 4638 |
| 41 | Ga0123353_10415746 | 3300010167 | Unclassified | 1995 |
| 42 | Ga0123353_11824051 | 3300010167 | Unclassified | 754 |
| 43 | Ga0123354_10000411 | 3300010882 | Bacteria | 41679 |
| 44 | Ga0123354_10790133 | 3300010882 | Bacteria | 642 |
| 45 | Ga0160469_108808 | 3300012824 | Bacteria | 917 |
| 46 | Ga0466696_070621 | 3300042596 | Bacteria | 6318 |
| 47 | Ga0466705_393782 | 3300042612 | Bacteria | 6456 |
| 48 | Ga0466711_157484 | 3300042615 | Bacteria | 3403 |
| 49 | Ga0466718_162471 | 3300042617 | Bacteria | 2567 |
| 50 | Ga0466723_088822 | 3300042618 | Unclassified | 3600 |
| 51 | Ga0466723_351338 | 3300042618 | Bacteria | 14588 |
| 52 | Ga0466723_369579 | 3300042618 | Unclassified | 1417 |
| 53 | Ga0466728_478687 | 3300042620 | Bacteria | 12796 |
| 54 | Ga0466728_481563 | 3300042620 | Bacteria | 45823 |
| 55 | Ga0466706_255544 | 3300042599 | Bacteria | 3958 |
| 56 | Ga0466713_054782 | 3300042602 | Bacteria | 6316 |
| 57 | Ga0466722_149438 | 3300042609 | Bacteria | 6511 |
| 58 | AustNasuHG_c1009870 | 3300000089 | Bacteria | 3339 |
| 59 | JGI24705J35276_12186698 | 3300002504 | Bacteria | 1422 |
| 60 | JGI24699J35502_10734986 | 3300002509 | Unclassified | 801 |
| 61 | Ga0466730_090102 | 3300042625 | Bacteria | 1950 |
| 62 | Ga0466724_30010 | 3300042649 | Unclassified | 17193 |
| 63 | Ga0466727_317160 | 3300042655 | Bacteria | 2378 |
| 64 | Ga0466705_360285 | 3300042612 | Bacteria | 15141 |
| 65 | Ga0562378_0005 | 3300056814 | Bacteria | 1949920 |
| 66 | Ga0123357_10079998 | 3300009784 | Bacteria | 4301 |
| 67 | Ga0123356_10005311 | 3300010049 | Bacteria | 13136 |
| 68 | Ga0123356_12128461 | 3300010049 | Bacteria | 701 |
| 69 | Ga0123353_10000701 | 3300010167 | Bacteria | 40961 |
| 70 | Ga0123353_10063253 | 3300010167 | Bacteria | 5936 |
| 71 | Ga0123353_12055925 | 3300010167 | Unclassified | 697 |
| 72 | Ga0123354_10508083 | 3300010882 | Bacteria | 935 |
| 73 | Ga0160468_112932 | 3300012819 | Bacteria | 776 |
| 74 | Ga0160460_108867 | 3300012845 | Bacteria | 1276 |
| 75 | Ga0160447_104744 | 3300012849 | Unclassified | 3943 |
| 76 | Ga0160430_101422 | 3300012852 | Bacteria | 8981 |
| 77 | Ga0466693_036673 | 3300042592 | Unclassified | 1642 |
| 78 | Ga0466693_114204 | 3300042592 | Bacteria | 1456 |
| 79 | Ga0466701_038084 | 3300042598 | Unclassified | 1150 |
| 80 | Ga0466713_007574 | 3300042602 | Bacteria | 2628 |
| 81 | Ga0466713_131568 | 3300042602 | Bacteria | 3083 |
| 82 | Ga0466714_051823 | 3300042603 | Bacteria | 3043 |
| 83 | Ga0466722_151361 | 3300042609 | Bacteria | 1694 |
| 84 | Ga0466697_053525 | 3300042611 | Bacteria | 2966 |
| 85 | JGI24705J35276_12219889 | 3300002504 | Bacteria | 2232 |
| 86 | Ga0466704_435504 | 3300042643 | Bacteria | 12524 |
| 87 | Ga0466704_458652 | 3300042643 | Unclassified | 3912 |
| 88 | Ga0466725_053069 | 3300042654 | Unclassified | 1240 |
| 89 | Ga0466697_267923 | 3300042611 | Unclassified | 1035 |
| 90 | Ga0466705_339036 | 3300042612 | Unclassified | 1825 |
| 91 | Ga0562378_2314 | 3300056814 | Bacteria | 16306 |
| 92 | Ga0562375_0042 | 3300056856 | Bacteria | 527811 |
| 93 | Ga0562376_0135 | 3300056857 | Bacteria | 162849 |
| 94 | Ga0123357_10003869 | 3300009784 | Bacteria | 17362 |
| 95 | Ga0123355_12009779 | 3300009826 | Unclassified | 536 |
| 96 | Ga0123356_10001761 | 3300010049 | Bacteria | 23598 |
| 97 | Ga0123356_11785199 | 3300010049 | Bacteria | 764 |
| 98 | Ga0123356_12125001 | 3300010049 | Bacteria | 701 |
| 99 | Ga0123353_10001881 | 3300010167 | Bacteria | 25776 |
| 100 | Ga0123353_10043525 | 3300010167 | Unclassified | 7114 |
| 101 | Ga0123353_10177474 | 3300010167 | Bacteria | 3376 |
| 102 | Ga0123353_10549367 | 3300010167 | Unclassified | 1666 |
| 103 | Ga0123354_10248995 | 3300010882 | Unclassified | 1806 |
| 104 | Ga0123354_11041413 | 3300010882 | Unclassified | 523 |
| 105 | Ga0160440_101830 | 3300012815 | Bacteria | 2465 |
| 106 | Ga0160443_133595 | 3300012848 | Bacteria | 517 |
| 107 | Ga0160436_1000932 | 3300012861 | Bacteria | 8946 |
| 108 | Ga0466710_139063 | 3300042613 | Bacteria | 1324 |
| 109 | Ga0466728_187823 | 3300042620 | Bacteria | 80385 |
| 110 | Ga0466706_066876 | 3300042599 | Bacteria | 2563 |
| 111 | Ga0466706_154978 | 3300042599 | Bacteria | 125008 |
| 112 | Ga0466713_140918 | 3300042602 | Bacteria | 6641 |
| 113 | Ga0466714_079023 | 3300042603 | Unclassified | 1008 |
| 114 | Ga0466716_431383 | 3300042605 | Bacteria | 1117 |
| 115 | Ga0466719_487053 | 3300042606 | Bacteria | 3536 |
| 116 | Ga0466722_138137 | 3300042609 | Bacteria | 96408 |
| 117 | Ga0072941_1210334 | 3300005201 | Bacteria | 3509 |
| 118 | Ga0074278_153075 | 3300005721 | Bacteria | 5436 |
| 119 | Ga0466734_111352 | 3300042623 | Bacteria | 1279 |
| 120 | Ga0466730_026113 | 3300042625 | Unclassified | 1132 |
| 121 | Ga0466703_203351 | 3300042636 | Bacteria | 31013 |
| 122 | Ga0466727_235291 | 3300042655 | Bacteria | 2378 |
| 123 | Ga0530661_000311 | 3300056564 | Bacteria | 37490 |
| 124 | Ga0562379_0066 | 3300056790 | Bacteria | 440869 |
| 125 | Ga0562378_0011 | 3300056814 | Bacteria | 1075031 |
| 126 | Ga0562376_2005 | 3300056857 | Bacteria | 26171 |
| 127 | Ga0123357_10232210 | 3300009784 | Unclassified | 2019 |
| 128 | Ga0123356_10012301 | 3300010049 | Unclassified | 8312 |
| 129 | Ga0123356_10229443 | 3300010049 | Bacteria | 1920 |
| 130 | Ga0123356_12994801 | 3300010049 | Bacteria | 590 |
| 131 | Ga0123353_10298728 | 3300010167 | Bacteria | 2460 |
| 132 | Ga0123353_10528187 | 3300010167 | Unclassified | 1709 |
| 133 | Ga0123353_12078683 | 3300010167 | Bacteria | 692 |
| 134 | Ga0123354_10472027 | 3300010882 | Unclassified | 999 |
| 135 | Ga0160456_100686 | 3300012820 | Bacteria | 9677 |
| 136 | Ga0160430_114131 | 3300012852 | Unclassified | 1241 |
| 137 | Ga0466657_084822 | 3300042582 | Unclassified | 1425 |
| 138 | Ga0466693_105307 | 3300042592 | Unclassified | 3940 |
| 139 | Ga0466693_353530 | 3300042592 | Bacteria | 63745 |
| 140 | Ga0466718_163651 | 3300042617 | Unclassified | 4026 |
| 141 | Ga0466723_154222 | 3300042618 | Bacteria | 4259 |
| 142 | Ga0466706_239941 | 3300042599 | Bacteria | 3566 |
| 143 | Ga0466713_148390 | 3300042602 | Bacteria | 1851 |
| 144 | Ga0466717_067483 | 3300042604 | Bacteria | 2754 |
| 145 | Ga0466698_441904 | 3300042610 | Unclassified | 1050 |
| 146 | Ga0466703_001193 | 3300042636 | Bacteria | 1755 |
| 147 | Ga0466703_115413 | 3300042636 | Bacteria | 35262 |
| 148 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 149 | Ga0466727_130995 | 3300042655 | Unclassified | 7977 |
| 150 | Ga0562375_0048 | 3300056856 | Bacteria | 473654 |
| 151 | Ga0562376_0281 | 3300056857 | Bacteria | 101378 |
| 152 | Ga0123355_10372067 | 3300009826 | Unclassified | 1871 |
| 153 | Ga0123356_10015582 | 3300010049 | Bacteria | 7281 |
| 154 | Ga0123353_10015717 | 3300010167 | Unclassified | 11017 |
| 155 | Ga0123354_10062562 | 3300010882 | Bacteria | 5479 |
| 156 | Ga0160459_101478 | 3300012831 | Bacteria | 5111 |
| 157 | Ga0160458_111506 | 3300012832 | Bacteria | 979 |
| 158 | Ga0160445_100065 | 3300012847 | Bacteria | 124684 |
| 159 | Ga0160443_100129 | 3300012848 | Bacteria | 114665 |
| 160 | Ga0160435_1035329 | 3300012857 | Bacteria | 752 |
| 161 | Ga0466657_023235 | 3300042582 | Unclassified | 1177 |
| 162 | Ga0466710_164580 | 3300042613 | Bacteria | 2243 |
| 163 | Ga0466718_104750 | 3300042617 | Unclassified | 1172 |
| 164 | Ga0466728_429627 | 3300042620 | Bacteria | 4010 |
| 165 | Ga0466717_008587 | 3300042604 | Bacteria | 4745 |
| 166 | Ga0466719_081642 | 3300042606 | Unclassified | 2074 |
| 167 | Ga0466719_121243 | 3300042606 | Bacteria | 21753 |
| 168 | AglaG_contig18921 | 2084038013 | Unclassified | 756 |
| 169 | AustNasuHG_c1040171 | 3300000089 | Unclassified | 1148 |
| 170 | JGI24703J35330_11541641 | 3300002501 | Unclassified | 1204 |
| 171 | Ga0068305_10062578 | 3300005083 | Bacteria | 6170 |
| 172 | Ga0072940_1086811 | 3300005200 | Bacteria | 3756 |
| 173 | Ga0123357_10000039 | 3300009784 | Bacteria | 105207 |
| 174 | Ga0466734_079040 | 3300042623 | Bacteria | 2439 |
| 175 | Ga0466730_076450 | 3300042625 | Bacteria | 3280 |
| 176 | Ga0466703_390459 | 3300042636 | Bacteria | 32848 |
| 177 | Ga0466704_502025 | 3300042643 | Bacteria | 7636 |
| 178 | Ga0466724_44340 | 3300042649 | Bacteria | 270960 |
| 179 | Ga0466725_074303 | 3300042654 | Bacteria | 1757 |
| 180 | Ga0466705_363842 | 3300042612 | Bacteria | 2834 |
| 181 | Ga0123357_10046244 | 3300009784 | Bacteria | 5903 |
| 182 | Ga0123357_10494224 | 3300009784 | Unclassified | 1022 |
| 183 | Ga0123356_10002223 | 3300010049 | Bacteria | 20899 |
| 184 | Ga0123356_10041987 | 3300010049 | Bacteria | 4262 |
| 185 | Ga0123356_10047053 | 3300010049 | Bacteria | 4014 |
| 186 | Ga0123353_13292065 | 3300010167 | Bacteria | 515 |
| 187 | Ga0123354_10144447 | 3300010882 | Bacteria | 2922 |
| 188 | Ga0123354_10244535 | 3300010882 | Unclassified | 1836 |
| 189 | Ga0160467_108460 | 3300012829 | Unclassified | 1022 |
| 190 | Ga0160443_100074 | 3300012848 | Bacteria | 181634 |
| 191 | Ga0160457_1002790 | 3300012858 | Bacteria | 3375 |
| 192 | Ga0160457_1005514 | 3300012858 | Bacteria | 1921 |
| 193 | Ga0466701_010160 | 3300042598 | Bacteria | 1577 |
| 194 | Ga0466711_292902 | 3300042615 | Bacteria | 14585 |
| 195 | Ga0466718_053118 | 3300042617 | Bacteria | 2018 |
| 196 | Ga0466718_054852 | 3300042617 | Unclassified | 1653 |
| 197 | Ga0466706_005779 | 3300042599 | Bacteria | 11077 |
| 198 | Ga0466706_221111 | 3300042599 | Bacteria | 4518 |
| 199 | Ga0466700_387247 | 3300042600 | Unclassified | 3346 |
| 200 | Ga0466707_382854 | 3300042601 | Bacteria | 200054 |
| 201 | Ga0466713_052629 | 3300042602 | Bacteria | 187952 |
| 202 | Ga0466713_126395 | 3300042602 | Unclassified | 1337 |
| 203 | Ga0466720_232729 | 3300042607 | Bacteria | 1017 |
| 204 | Ga0123357_10000113 | 3300009784 | Bacteria | 68545 |
| 205 | Ga0466725_079863 | 3300042654 | Bacteria | 1619 |
| 206 | Ga0466725_208271 | 3300042654 | Bacteria | 2199 |
| 207 | Ga0466697_146633 | 3300042611 | Bacteria | 3339 |
| 208 | Ga0562377_0222 | 3300056842 | Unclassified | 139834 |
| 209 | Ga0123357_10336940 | 3300009784 | Unclassified | 1465 |
| 210 | Ga0123355_10276230 | 3300009826 | Unclassified | 2326 |
| 211 | Ga0123356_11380954 | 3300010049 | Unclassified | 865 |
| 212 | Ga0123353_10406732 | 3300010167 | Bacteria | 2023 |
| 213 | Ga0123353_10991218 | 3300010167 | Bacteria | 1130 |
| 214 | Ga0123354_10396007 | 3300010882 | Unclassified | 1175 |
| 215 | Ga0123354_10539632 | 3300010882 | Unclassified | 886 |
| 216 | Ga0160454_101952 | 3300012798 | Bacteria | 2615 |
| 217 | Ga0160442_100131 | 3300012806 | Unclassified | 75763 |
| 218 | Ga0160431_106324 | 3300012828 | Unclassified | 1814 |
| 219 | Ga0160446_100007 | 3300012835 | Bacteria | 393914 |
| 220 | Ga0160447_101811 | 3300012849 | Unclassified | 7958 |
| 221 | Ga0466657_257638 | 3300042582 | Bacteria | 1385 |
| 222 | Ga0466693_425160 | 3300042592 | Unclassified | 1010 |
| 223 | Ga0466710_105544 | 3300042613 | Bacteria | 2245 |
| 224 | Ga0466712_129159 | 3300042614 | Unclassified | 2357 |
| 225 | Ga0466718_096733 | 3300042617 | Unclassified | 1748 |
| 226 | Ga0466723_109357 | 3300042618 | Bacteria | 1442 |
| 227 | Ga0466723_243237 | 3300042618 | Bacteria | 11730 |
| 228 | Ga0466706_112909 | 3300042599 | Bacteria | 3716 |
| 229 | Ga0466706_149584 | 3300042599 | Bacteria | 1736 |
| 230 | Ga0466713_029749 | 3300042602 | Bacteria | 63401 |
| 231 | Ga0466720_135195 | 3300042607 | Bacteria | 1001 |
| 232 | AglaG_contig18100 | 2084038013 | Unclassified | 1956 |
| 233 | Ga0466703_218765 | 3300042636 | Bacteria | 20663 |
| 234 | Ga0466703_389845 | 3300042636 | Bacteria | 1048 |
| 235 | Ga0466704_582723 | 3300042643 | Bacteria | 43560 |
| 236 | Ga0466724_13900 | 3300042649 | Unclassified | 1433 |
| 237 | Ga0466724_64021 | 3300042649 | Bacteria | 2766 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00411 | Ribosomal_S11 | Ribosomal protein S11 | 38 | 147 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.