Protein Family IF10551
Metagenome
Isolate
244
Members
185
Samples
118
Scaffolds
242.42
Avg Length
Representative Sequence
- ID
- 3300056842|Ga0562377_0078|Ga0562377_0078_8207_9022
- Length
- 271 aa
- Sequence
- VEIFSKYYKYDIIFKKCGGNFVAGHSKWANIKHRKGRQDAQRAKIFTRIGKELTIAAKLGGGDTGFNPRLRLAVDKAKAANMPKDNMERAIKKGTGELEGVDYQEIRYEGYGPGGVAFLVDVVTDNKNRSASTVRMNFSRNDGNLGETGSVSFLFNRKGIFEFKKEGITEDMLMETALDAGAEDVVEKSESWLVITEPNDFDAVKEVFDTNNLKYEEGEITMHPATEIEITDEETAKKLMKLYDDLEENEDVQEIYSNFDISDEIMAKLED
Sample Types
Isolate
51.6%
Metagenome
48.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
44.2%
Unclassified
11.6%
Formicidae
9.9%
Termitidae
7.7%
Kalotermitidae
6.1%
Elmidae
3.3%
Culicidae
2.2%
Armadillidiidae
2.2%
Curculionidae
1.7%
Largidae
1.1%
Alydidae
1.1%
Berytidae
1.1%
Passalidae
1.1%
Drosophilidae
1.1%
Nephropidae
1.1%
Hydrophilidae
1.1%
Ixodidae
1.1%
Crambidae
0.6%
Tenebrionidae
0.6%
Calliphoridae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
0
Bacteria
230
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 3 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 4 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 5 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 6 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 14 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 15 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 16 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 17 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 18 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 19 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 20 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 21 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 22 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 23 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 24 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 25 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 26 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 27 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 28 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 29 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 30 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 31 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 32 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 33 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 34 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 35 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 38 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 39 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 40 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 41 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 42 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 43 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 44 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 45 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 46 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 47 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 48 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 49 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 50 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 51 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 52 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 56 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 57 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 58 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 59 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 60 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 61 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 62 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 63 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 64 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 65 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 66 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 67 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 68 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 69 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 70 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 71 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 72 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 73 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 74 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 75 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 76 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 77 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 78 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 79 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 80 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 81 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 82 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 83 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 84 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 85 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 86 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 87 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 88 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 89 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 90 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 91 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 92 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 93 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 94 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 95 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 96 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 97 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 98 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 99 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 100 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 101 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 102 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 103 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 104 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 105 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 106 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 107 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 108 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 109 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 110 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 111 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 112 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 113 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 114 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 115 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 116 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 117 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 118 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 119 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 120 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 121 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 122 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 123 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 124 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 125 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 126 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 127 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 128 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 129 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 130 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 131 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 132 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 133 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 134 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 135 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 136 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 137 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 138 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 139 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 140 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 141 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 142 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 143 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 144 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 145 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 146 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 147 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 148 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 149 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 150 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 151 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 152 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 153 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 154 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 155 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 156 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 157 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 158 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 159 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 160 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 161 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 162 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 163 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 164 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 165 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 166 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 167 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 168 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 169 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 170 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 171 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 172 | 2802429587 | Spiroplasma eriocheiris CCTCC 'M 207170' | Isolate | Unclassified |
| 173 | 2558860181 | Spiroplasma mirum ATCC 29335 | Isolate | Ixodidae |
| 174 | 2558860251 | Spiroplasma mirum SMCA | Isolate | Ixodidae |
| 175 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 176 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 177 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 178 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 179 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 180 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 181 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 182 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 183 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 184 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 185 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160452_100076 | 3300012834 | Bacteria | 131624 |
| 2 | Ga0160472_100119 | 3300012839 | Bacteria | 124226 |
| 3 | Ga0160447_100179 | 3300012849 | Bacteria | 39549 |
| 4 | Ga0160447_102060 | 3300012849 | Bacteria | 7326 |
| 5 | Ga0415639_206063 | 3300038395 | Bacteria | 1407 |
| 6 | Ga0466701_004830 | 3300042598 | Unclassified | 5379 |
| 7 | Ga0466719_147235 | 3300042606 | Bacteria | 2494 |
| 8 | IMNBL1DRAFT_c0012344 | 3300000062 | Bacteria | 3913 |
| 9 | Ga0103265_1003730 | 3300007068 | Bacteria | 2222 |
| 10 | Ga0102739_1003337 | 3300007095 | Unclassified | 2367 |
| 11 | Ga0105005_1109943 | 3300007505 | Unclassified | 2586 |
| 12 | Ga0466734_044547 | 3300042623 | Bacteria | 23470 |
| 13 | Ga0466703_311596 | 3300042636 | Bacteria | 21197 |
| 14 | Ga0466704_533642 | 3300042643 | Bacteria | 39754 |
| 15 | Ga0466724_46819 | 3300042649 | Bacteria | 306737 |
| 16 | Ga0466725_054435 | 3300042654 | Bacteria | 2049 |
| 17 | Ga0466711_402580 | 3300042615 | Bacteria | 1737 |
| 18 | Ga0466718_017004 | 3300042617 | Bacteria | 2571 |
| 19 | Ga0562377_0078 | 3300056842 | Bacteria | 380003 |
| 20 | Ga0160472_101439 | 3300012839 | Unclassified | 6997 |
| 21 | Ga0160472_106227 | 3300012839 | Unclassified | 1800 |
| 22 | Ga0160448_111486 | 3300012854 | Bacteria | 1803 |
| 23 | Ga0160457_1000028 | 3300012858 | Bacteria | 284184 |
| 24 | Ga0123356_10622157 | 3300010049 | Bacteria | 1245 |
| 25 | Ga0466701_037076 | 3300042598 | Bacteria | 58845 |
| 26 | Ga0466701_099665 | 3300042598 | Bacteria | 2650 |
| 27 | CVPL005W_1000124 | 3300002934 | Bacteria | 32767 |
| 28 | CVPL005L_10001011 | 3300002938 | Bacteria | 31524 |
| 29 | Ga0103263_101474 | 3300007042 | Unclassified | 3044 |
| 30 | Ga0102736_1001803 | 3300007052 | Bacteria | 6201 |
| 31 | Ga0102740_1000929 | 3300007140 | Bacteria | 8210 |
| 32 | Ga0103264_1000148 | 3300007188 | Bacteria | 54758 |
| 33 | Ga0103264_1006549 | 3300007188 | Bacteria | 7709 |
| 34 | Ga0105005_1105635 | 3300007505 | Bacteria | 2590 |
| 35 | Ga0466730_046718 | 3300042625 | Bacteria | 68019 |
| 36 | Ga0466730_097282 | 3300042625 | Bacteria | 177552 |
| 37 | Ga0466703_090547 | 3300042636 | Bacteria | 47834 |
| 38 | Ga0466704_369941 | 3300042643 | Bacteria | 2093 |
| 39 | Ga0466715_092219 | 3300042616 | Bacteria | 17508 |
| 40 | Ga0466705_256586 | 3300042612 | Bacteria | 9209 |
| 41 | Ga0466733_182039 | 3300042659 | Bacteria | 10236 |
| 42 | Ga0123353_10003549 | 3300010167 | Bacteria | 19751 |
| 43 | Ga0123353_10048719 | 3300010167 | Bacteria | 6748 |
| 44 | Ga0466701_026306 | 3300042598 | Unclassified | 1731 |
| 45 | CVPL010W_10033814 | 3300002931 | Bacteria | 1845 |
| 46 | Ga0102737_1000153 | 3300007142 | Bacteria | 22554 |
| 47 | Ga0123357_10000047 | 3300009784 | Bacteria | 99859 |
| 48 | Ga0466725_375654 | 3300042654 | Bacteria | 10809 |
| 49 | Ga0466711_339210 | 3300042615 | Bacteria | 1281 |
| 50 | Ga0466728_015710 | 3300042620 | Bacteria | 22492 |
| 51 | Ga0160468_100034 | 3300012819 | Bacteria | 232419 |
| 52 | Ga0160467_100035 | 3300012829 | Bacteria | 221416 |
| 53 | Ga0160430_104189 | 3300012852 | Bacteria | 3675 |
| 54 | CVPL010W_10004026 | 3300002931 | Bacteria | 35308 |
| 55 | CVPL010W_10016857 | 3300002931 | Bacteria | 5964 |
| 56 | Ga0103266_1000251 | 3300007067 | Bacteria | 18949 |
| 57 | Ga0102737_1000194 | 3300007142 | Unclassified | 20732 |
| 58 | Ga0105005_1010989 | 3300007505 | Unclassified | 2601 |
| 59 | Ga0160468_102224 | 3300012819 | Bacteria | 3552 |
| 60 | Ga0160447_113544 | 3300012849 | Bacteria | 1599 |
| 61 | Ga0466696_278148 | 3300042596 | Unclassified | 1218 |
| 62 | Ga0123353_10003017 | 3300010167 | Bacteria | 21064 |
| 63 | Ga0466706_020002 | 3300042599 | Bacteria | 1602 |
| 64 | Ga0466707_065918 | 3300042601 | Bacteria | 1579 |
| 65 | CVPL005L_10000024 | 3300002938 | Bacteria | 117333 |
| 66 | Ga0103261_1003283 | 3300007083 | Unclassified | 3807 |
| 67 | Ga0103261_1005002 | 3300007083 | Bacteria | 1972 |
| 68 | Ga0102734_1000668 | 3300007129 | Bacteria | 9490 |
| 69 | Ga0103260_1001904 | 3300007139 | Bacteria | 3622 |
| 70 | Ga0104048_1169924 | 3300007143 | Bacteria | 1818 |
| 71 | Ga0103268_1001083 | 3300007192 | Bacteria | 7196 |
| 72 | Ga0466703_225365 | 3300042636 | Bacteria | 4076 |
| 73 | Ga0160444_100110 | 3300012841 | Bacteria | 96308 |
| 74 | Ga0123353_10000321 | 3300010167 | Bacteria | 59258 |
| 75 | Ga0160464_100002 | 3300012805 | Bacteria | 416329 |
| 76 | Ga0160464_100182 | 3300012805 | Bacteria | 64573 |
| 77 | Ga0466716_506237 | 3300042605 | Bacteria | 10992 |
| 78 | 2227476832 | 2225789004 | Unclassified | 879 |
| 79 | CVPL010W_10005960 | 3300002931 | Bacteria | 12756 |
| 80 | Ga0102736_1000999 | 3300007052 | Bacteria | 13339 |
| 81 | Ga0103264_1000206 | 3300007188 | Bacteria | 33853 |
| 82 | Ga0103264_1000240 | 3300007188 | Bacteria | 40495 |
| 83 | Ga0466703_071861 | 3300042636 | Bacteria | 17885 |
| 84 | Ga0466709_024540 | 3300042648 | Bacteria | 5558 |
| 85 | Ga0466724_52883 | 3300042649 | Bacteria | 459297 |
| 86 | Ga0466705_497846 | 3300042612 | Bacteria | 10930 |
| 87 | Ga0466711_494637 | 3300042615 | Bacteria | 3244 |
| 88 | Ga0466715_076381 | 3300042616 | Bacteria | 36547 |
| 89 | Ga0466693_085023 | 3300042592 | Bacteria | 1806 |
| 90 | Ga0466696_138365 | 3300042596 | Bacteria | 6651 |
| 91 | Ga0466701_029299 | 3300042598 | Bacteria | 5010 |
| 92 | Ga0102738_1000179 | 3300007141 | Bacteria | 14742 |
| 93 | Ga0103264_1000467 | 3300007188 | Bacteria | 42232 |
| 94 | Ga0103267_1000719 | 3300007190 | Bacteria | 22558 |
| 95 | Ga0103268_1000373 | 3300007192 | Bacteria | 14211 |
| 96 | Ga0466734_065066 | 3300042623 | Bacteria | 5791 |
| 97 | Ga0466734_163010 | 3300042623 | Bacteria | 2989 |
| 98 | Ga0466730_052567 | 3300042625 | Bacteria | 9022 |
| 99 | Ga0466730_067983 | 3300042625 | Bacteria | 4731 |
| 100 | Ga0466703_101688 | 3300042636 | Bacteria | 41897 |
| 101 | Ga0466724_14509 | 3300042649 | Bacteria | 10744 |
| 102 | Ga0466725_063726 | 3300042654 | Bacteria | 2466 |
| 103 | Ga0466733_163823 | 3300042659 | Bacteria | 1745 |
| 104 | Ga0160430_107181 | 3300012852 | Bacteria | 2271 |
| 105 | Ga0415639_147602 | 3300038395 | Bacteria | 3503 |
| 106 | Ga0466657_269597 | 3300042582 | Bacteria | 13405 |
| 107 | Ga0123356_10445434 | 3300010049 | Bacteria | 1442 |
| 108 | Ga0160471_106597 | 3300012812 | Unclassified | 1445 |
| 109 | Ga0466701_079388 | 3300042598 | Bacteria | 130298 |
| 110 | Ga0466716_083991 | 3300042605 | Bacteria | 7024 |
| 111 | CVPL010W_10006354 | 3300002931 | Bacteria | 21839 |
| 112 | Ga0103266_1000110 | 3300007067 | Bacteria | 28918 |
| 113 | Ga0103261_1010467 | 3300007083 | Unclassified | 1296 |
| 114 | Ga0102739_1005775 | 3300007095 | Bacteria | 1681 |
| 115 | Ga0102737_1000367 | 3300007142 | Bacteria | 15226 |
| 116 | Ga0103264_1000004 | 3300007188 | Bacteria | 153563 |
| 117 | Ga0466725_431499 | 3300042654 | Bacteria | 1547 |
| 118 | Ga0466723_157817 | 3300042618 | Bacteria | 5999 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.