Protein Family IF10455
Metagenome
Isolate
399
Members
232
Samples
242
Scaffolds
104.24
Avg Length
Representative Sequence
- ID
- 3300056814|Ga0562378_0006|Ga0562378_0006_1632869_1633237
- Length
- 122 aa
- Sequence
- MRGGVKANRPSRPSRRGDPYTVSAEDLEDYEANVELSMYREYRDVVSQFSYVVETERRFYLANAVELIPRNSGGEVYYEVRMSDAWVWDMYRPARFVRYVRVITYKDVNIEELDKPDLRLPE
Sample Types
Isolate
39.4%
Metagenome
60.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.8%
Termitidae
14.2%
Apidae
9.1%
Formicidae
8.7%
Anthocoridae
4.6%
Kalotermitidae
4.6%
Culicidae
4.6%
Tenebrionidae
3.7%
Cambaridae
3.2%
Scarabaeidae
2.7%
Armadillidiidae
2.7%
Hydrophilidae
1.8%
Elmidae
1.8%
Termopsidae
1.4%
Dytiscidae
1.4%
Curculionidae
0.9%
Cerambycidae
0.9%
Chironomidae
0.5%
Ixodidae
0.5%
Rhinotermitidae
0.5%
Cimicidae
0.5%
Reduviidae
0.5%
Siricidae
0.5%
Pentatomidae
0.5%
Pyralidae
0.5%
Thomisidae
0.5%
Hodotermitidae
0.5%
Passalidae
0.5%
Taxonomy
Archaea
0
Bacteria
331
Eukaryota
0
Viruses
0
Unclassified
68
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 3 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 4 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 5 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 6 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 7 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 8 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 9 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 10 | 2821316722 | Unclassified Actinobacteria Lab288P1bin78 | Isolate | Unclassified |
| 11 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 12 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 13 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 14 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 15 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 16 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 17 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 22 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 23 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 24 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 25 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 31 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 32 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 33 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 34 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 35 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 36 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 37 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 38 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 39 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 40 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 41 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 42 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 43 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 44 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 47 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 48 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 49 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 50 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 56 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 57 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 58 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 59 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 60 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 61 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 62 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 63 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 64 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 65 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 66 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 67 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 68 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 69 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 70 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 71 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 72 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 73 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 74 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 75 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 76 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 77 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 78 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 81 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 82 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 83 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 84 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 85 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 86 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 87 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 88 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 89 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 90 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 91 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 92 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 93 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 94 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 95 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 96 | 2873603790 | Tessaracoccus coleopterorum HDW20 | Isolate | Hydrophilidae |
| 97 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 98 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 99 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 100 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 101 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 102 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 103 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 104 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 105 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 106 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 107 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 108 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 109 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 110 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 111 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 112 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 113 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 114 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 115 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 116 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 117 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 118 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 119 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 120 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 121 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 122 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 123 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 124 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 125 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 126 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 127 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 128 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 129 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 130 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 131 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 132 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 133 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 134 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 135 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 136 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 137 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 138 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 139 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 140 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 141 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 142 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 143 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 144 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 145 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 146 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 147 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 148 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 149 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 150 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 151 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 152 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 153 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 154 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 155 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 156 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 157 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 158 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 159 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 160 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 161 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 162 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 163 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 164 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 165 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 166 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 167 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 168 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 169 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 170 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 171 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 172 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 173 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 174 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 175 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 176 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 177 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 178 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 179 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 180 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 181 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 182 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 183 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 184 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 185 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 186 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 187 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 188 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 189 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 190 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 191 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 192 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 193 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 194 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 195 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 196 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 197 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 198 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 199 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 200 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 201 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 202 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 203 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 204 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 205 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 206 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 207 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 208 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 209 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 210 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 211 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 212 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 213 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 214 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 215 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 216 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 217 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 218 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 219 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 220 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 221 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 222 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 223 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 224 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 225 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 226 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 227 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 228 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 229 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 230 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 231 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 232 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 2 | Ga0562379_2327 | 3300056790 | Bacteria | 16154 |
| 3 | Ga0562378_0006 | 3300056814 | Bacteria | 1902205 |
| 4 | Ga0562375_1756 | 3300056856 | Bacteria | 27230 |
| 5 | Ga0160446_100024 | 3300012835 | Bacteria | 211774 |
| 6 | Ga0160472_114625 | 3300012839 | Unclassified | 862 |
| 7 | Ga0160444_106222 | 3300012841 | Bacteria | 1560 |
| 8 | Ga0123357_10051262 | 3300009784 | Unclassified | 5579 |
| 9 | Ga0123357_10286344 | 3300009784 | Bacteria | 1692 |
| 10 | Ga0123355_11624345 | 3300009826 | Unclassified | 621 |
| 11 | Ga0123356_10193275 | 3300010049 | Bacteria | 2068 |
| 12 | Ga0123356_11059229 | 3300010049 | Bacteria | 980 |
| 13 | Ga0123353_10000879 | 3300010167 | Bacteria | 36622 |
| 14 | Ga0123353_10014321 | 3300010167 | Unclassified | 11423 |
| 15 | Ga0123353_10020422 | 3300010167 | Unclassified | 9894 |
| 16 | Ga0123353_10304173 | 3300010167 | Unclassified | 2432 |
| 17 | Ga0123354_10003412 | 3300010882 | Unclassified | 21906 |
| 18 | Ga0123354_10012259 | 3300010882 | Unclassified | 13284 |
| 19 | Ga0466717_148835 | 3300042604 | Bacteria | 2104 |
| 20 | Ga0466698_368874 | 3300042610 | Bacteria | 3644 |
| 21 | AglaG_contig08633 | 2084038013 | Bacteria | 553 |
| 22 | AustNasuHG_c1014757 | 3300000089 | Bacteria | 2647 |
| 23 | HBC_ctgsDRAFT_1032417 | 3300000333 | Unclassified | 1284 |
| 24 | Ga0466705_151530 | 3300042612 | Bacteria | 2080 |
| 25 | Ga0466727_169322 | 3300042655 | Bacteria | 1777 |
| 26 | Ga0466718_165541 | 3300042617 | Bacteria | 1390 |
| 27 | Ga0466723_298593 | 3300042618 | Bacteria | 4439 |
| 28 | Ga0562377_0107 | 3300056842 | Bacteria | 267817 |
| 29 | Ga0562376_0535 | 3300056857 | Bacteria | 67534 |
| 30 | Ga0562376_5546 | 3300056857 | Unclassified | 7955 |
| 31 | Ga0160456_102444 | 3300012820 | Bacteria | 3422 |
| 32 | Ga0160458_108477 | 3300012832 | Unclassified | 1174 |
| 33 | Ga0466657_073819 | 3300042582 | Bacteria | 9021 |
| 34 | Ga0466696_311842 | 3300042596 | Bacteria | 1259 |
| 35 | Ga0123357_10100410 | 3300009784 | Unclassified | 3734 |
| 36 | Ga0123357_10185985 | 3300009784 | Unclassified | 2410 |
| 37 | Ga0123355_10007450 | 3300009826 | Unclassified | 16398 |
| 38 | Ga0123355_10204556 | 3300009826 | Bacteria | 2875 |
| 39 | Ga0123355_11621718 | 3300009826 | Bacteria | 622 |
| 40 | Ga0123356_10085762 | 3300010049 | Unclassified | 2988 |
| 41 | Ga0123356_10476562 | 3300010049 | Bacteria | 1400 |
| 42 | Ga0123353_12208902 | 3300010167 | Unclassified | 665 |
| 43 | Ga0123354_10191227 | 3300010882 | Bacteria | 2290 |
| 44 | Ga0466706_027365 | 3300042599 | Unclassified | 3472 |
| 45 | Ga0466706_255052 | 3300042599 | Unclassified | 1331 |
| 46 | Ga0466713_085340 | 3300042602 | Bacteria | 38840 |
| 47 | Ga0466713_122596 | 3300042602 | Unclassified | 3754 |
| 48 | Ga0466719_126574 | 3300042606 | Bacteria | 13434 |
| 49 | AustNasuHG_c1003801 | 3300000089 | Unclassified | 5441 |
| 50 | AustNasuHG_c1021438 | 3300000089 | Bacteria | 2092 |
| 51 | JGI24699J35502_11134187 | 3300002509 | Bacteria | 48001 |
| 52 | Ga0072940_1128443 | 3300005200 | Bacteria | 7483 |
| 53 | Ga0072941_1205253 | 3300005201 | Unclassified | 6371 |
| 54 | Ga0466705_169094 | 3300042612 | Unclassified | 2060 |
| 55 | Ga0466704_155957 | 3300042643 | Bacteria | 3475 |
| 56 | Ga0466704_251546 | 3300042643 | Bacteria | 6600 |
| 57 | Ga0466724_36901 | 3300042649 | Bacteria | 9779 |
| 58 | Ga0466708_114567 | 3300042652 | Bacteria | 3575 |
| 59 | Ga0466718_043155 | 3300042617 | Bacteria | 1969 |
| 60 | Ga0466723_267715 | 3300042618 | Unclassified | 19277 |
| 61 | Ga0466728_233515 | 3300042620 | Unclassified | 2296 |
| 62 | Ga0562379_0345 | 3300056790 | Bacteria | 112065 |
| 63 | Ga0562376_0002 | 3300056857 | Bacteria | 3502070 |
| 64 | Ga0562376_3727 | 3300056857 | Bacteria | 14653 |
| 65 | Ga0160453_111558 | 3300012814 | Unclassified | 939 |
| 66 | Ga0160456_107981 | 3300012820 | Bacteria | 1164 |
| 67 | Ga0160443_100018 | 3300012848 | Bacteria | 423460 |
| 68 | Ga0264413_164219 | 3300024493 | Bacteria | 1535 |
| 69 | Ga0466693_179905 | 3300042592 | Bacteria | 56896 |
| 70 | Ga0466696_072461 | 3300042596 | Bacteria | 18501 |
| 71 | Ga0466696_313123 | 3300042596 | Bacteria | 8877 |
| 72 | Ga0123355_11508029 | 3300009826 | Bacteria | 655 |
| 73 | Ga0123356_10041370 | 3300010049 | Bacteria | 4294 |
| 74 | Ga0123354_10679959 | 3300010882 | Bacteria | 726 |
| 75 | Ga0160464_102010 | 3300012805 | Unclassified | 4575 |
| 76 | Ga0466707_297250 | 3300042601 | Bacteria | 1708 |
| 77 | Ga0466713_038872 | 3300042602 | Unclassified | 34558 |
| 78 | Ga0466713_154529 | 3300042602 | Bacteria | 5272 |
| 79 | JGI24705J35276_11996913 | 3300002504 | Bacteria | 844 |
| 80 | JGI24699J35502_10941410 | 3300002509 | Unclassified | 1146 |
| 81 | Ga0072940_1029200 | 3300005200 | Bacteria | 5400 |
| 82 | Ga0123357_10000059 | 3300009784 | Bacteria | 86528 |
| 83 | Ga0466705_090270 | 3300042612 | Bacteria | 1272 |
| 84 | Ga0466705_143916 | 3300042612 | Bacteria | 2761 |
| 85 | Ga0466730_015192 | 3300042625 | Unclassified | 11847 |
| 86 | Ga0466704_409003 | 3300042643 | Unclassified | 21335 |
| 87 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 88 | Ga0466715_107652 | 3300042616 | Unclassified | 2926 |
| 89 | Ga0466718_115038 | 3300042617 | Bacteria | 5544 |
| 90 | Ga0466729_176340 | 3300042621 | Bacteria | 3023 |
| 91 | Ga0466733_071704 | 3300042659 | Bacteria | 20440 |
| 92 | Ga0562375_2602 | 3300056856 | Bacteria | 19634 |
| 93 | Ga0160445_100011 | 3300012847 | Bacteria | 286054 |
| 94 | Ga0160434_109099 | 3300012850 | Bacteria | 1624 |
| 95 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 96 | Ga0123356_10045735 | 3300010049 | Bacteria | 4072 |
| 97 | Ga0123353_10007175 | 3300010167 | Bacteria | 15016 |
| 98 | Ga0123353_10648244 | 3300010167 | Unclassified | 1496 |
| 99 | Ga0160454_102414 | 3300012798 | Unclassified | 2061 |
| 100 | Ga0466714_124872 | 3300042603 | Bacteria | 4255 |
| 101 | Ga0466717_265625 | 3300042604 | Bacteria | 3147 |
| 102 | Ga0466697_042390 | 3300042611 | Bacteria | 4720 |
| 103 | AglaG_contig06331 | 2084038013 | Bacteria | 628 |
| 104 | AglaG_contig19126 | 2084038013 | Bacteria | 2725 |
| 105 | HBC_ctgsDRAFT_1136744 | 3300000333 | Unclassified | 543 |
| 106 | Ga0072940_1209228 | 3300005200 | Bacteria | 1249 |
| 107 | Ga0123357_10001082 | 3300009784 | Unclassified | 28132 |
| 108 | Ga0466730_042383 | 3300042625 | Bacteria | 2391 |
| 109 | Ga0466730_086488 | 3300042625 | Unclassified | 1085 |
| 110 | Ga0466703_154667 | 3300042636 | Bacteria | 5453 |
| 111 | Ga0466703_275434 | 3300042636 | Bacteria | 36391 |
| 112 | Ga0466704_208953 | 3300042643 | Bacteria | 83484 |
| 113 | Ga0466718_044362 | 3300042617 | Bacteria | 4912 |
| 114 | Ga0466723_105488 | 3300042618 | Bacteria | 7788 |
| 115 | Ga0466726_285877 | 3300042619 | Unclassified | 1283 |
| 116 | Ga0466728_313904 | 3300042620 | Bacteria | 3820 |
| 117 | Ga0530661_001487 | 3300056564 | Unclassified | 11487 |
| 118 | Ga0160452_114806 | 3300012834 | Unclassified | 873 |
| 119 | Ga0160445_136694 | 3300012847 | Unclassified | 577 |
| 120 | Ga0160447_101611 | 3300012849 | Unclassified | 8615 |
| 121 | Ga0160430_102676 | 3300012852 | Unclassified | 5464 |
| 122 | Ga0123357_10773392 | 3300009784 | Bacteria | 659 |
| 123 | Ga0123356_10003955 | 3300010049 | Bacteria | 15402 |
| 124 | Ga0123356_10026608 | 3300010049 | Bacteria | 5427 |
| 125 | Ga0123356_10274245 | 3300010049 | Unclassified | 1778 |
| 126 | Ga0123354_10066152 | 3300010882 | Unclassified | 5282 |
| 127 | Ga0123354_10435853 | 3300010882 | Unclassified | 1075 |
| 128 | Ga0160464_100508 | 3300012805 | Bacteria | 27538 |
| 129 | Ga0466706_036373 | 3300042599 | Bacteria | 1212 |
| 130 | Ga0466706_094277 | 3300042599 | Bacteria | 9890 |
| 131 | Ga0466713_101616 | 3300042602 | Bacteria | 503322 |
| 132 | IMNBGM34_c012339 | 3300000036 | Bacteria | 1071 |
| 133 | Ga0072940_1601439 | 3300005200 | Bacteria | 656 |
| 134 | Ga0466730_029426 | 3300042625 | Bacteria | 2654 |
| 135 | Ga0466703_194617 | 3300042636 | Bacteria | 59287 |
| 136 | Ga0466703_347099 | 3300042636 | Bacteria | 1228 |
| 137 | Ga0466704_614523 | 3300042643 | Bacteria | 62340 |
| 138 | Ga0466724_26537 | 3300042649 | Bacteria | 56648 |
| 139 | Ga0466708_034009 | 3300042652 | Bacteria | 2539 |
| 140 | Ga0466725_337491 | 3300042654 | Bacteria | 4340 |
| 141 | Ga0466715_451837 | 3300042616 | Unclassified | 2083 |
| 142 | Ga0466729_072804 | 3300042621 | Bacteria | 1296 |
| 143 | Ga0562376_1739 | 3300056857 | Bacteria | 29253 |
| 144 | Ga0562374_0033 | 3300057007 | Bacteria | 738333 |
| 145 | Ga0160432_100334 | 3300012818 | Unclassified | 36095 |
| 146 | Ga0160432_101981 | 3300012818 | Unclassified | 5222 |
| 147 | Ga0160441_100619 | 3300012825 | Bacteria | 22203 |
| 148 | Ga0160447_100028 | 3300012849 | Bacteria | 228026 |
| 149 | Ga0160448_116914 | 3300012854 | Bacteria | 1272 |
| 150 | Ga0160435_1004011 | 3300012857 | Bacteria | 3438 |
| 151 | Ga0466693_305338 | 3300042592 | Bacteria | 4506 |
| 152 | Ga0466691_106730 | 3300042593 | Bacteria | 11504 |
| 153 | Ga0466696_459593 | 3300042596 | Bacteria | 2237 |
| 154 | Ga0123355_10007387 | 3300009826 | Bacteria | 16456 |
| 155 | Ga0123355_10539961 | 3300009826 | Unclassified | 1416 |
| 156 | Ga0123356_10000048 | 3300010049 | Bacteria | 129914 |
| 157 | Ga0123356_10005950 | 3300010049 | Bacteria | 12380 |
| 158 | Ga0123356_12641719 | 3300010049 | Bacteria | 629 |
| 159 | Ga0160464_104256 | 3300012805 | Bacteria | 1835 |
| 160 | Ga0160471_113269 | 3300012812 | Bacteria | 842 |
| 161 | Ga0466700_108440 | 3300042600 | Bacteria | 1172 |
| 162 | Ga0466713_001288 | 3300042602 | Bacteria | 11875 |
| 163 | Ga0466719_138891 | 3300042606 | Bacteria | 99480 |
| 164 | Ga0072940_1075051 | 3300005200 | Bacteria | 8010 |
| 165 | Ga0072940_1462471 | 3300005200 | Bacteria | 636 |
| 166 | Ga0074278_139522 | 3300005721 | Bacteria | 663 |
| 167 | Ga0466730_090620 | 3300042625 | Unclassified | 2171 |
| 168 | Ga0466703_166237 | 3300042636 | Bacteria | 199031 |
| 169 | Ga0466703_378589 | 3300042636 | Bacteria | 7809 |
| 170 | Ga0466715_020843 | 3300042616 | Bacteria | 77878 |
| 171 | Ga0466715_326294 | 3300042616 | Bacteria | 1263 |
| 172 | Ga0466723_234070 | 3300042618 | Unclassified | 1629 |
| 173 | Ga0466723_234427 | 3300042618 | Bacteria | 17603 |
| 174 | Ga0466723_235478 | 3300042618 | Bacteria | 2960 |
| 175 | Ga0466728_128869 | 3300042620 | Bacteria | 4010 |
| 176 | Ga0466733_187582 | 3300042659 | Bacteria | 87354 |
| 177 | Ga0562379_0002 | 3300056790 | Bacteria | 3501209 |
| 178 | Ga0562378_0196 | 3300056814 | Unclassified | 147267 |
| 179 | Ga0562377_0076 | 3300056842 | Bacteria | 380477 |
| 180 | Ga0562375_1459 | 3300056856 | Bacteria | 31780 |
| 181 | Ga0562376_0327 | 3300056857 | Unclassified | 94067 |
| 182 | Ga0160453_113796 | 3300012814 | Bacteria | 783 |
| 183 | Ga0160446_122145 | 3300012835 | Unclassified | 714 |
| 184 | Ga0160455_101493 | 3300012837 | Bacteria | 6849 |
| 185 | Ga0466696_064205 | 3300042596 | Bacteria | 16478 |
| 186 | Ga0123356_11585759 | 3300010049 | Bacteria | 810 |
| 187 | Ga0123353_10445247 | 3300010167 | Bacteria | 1909 |
| 188 | Ga0123353_12930841 | 3300010167 | Bacteria | 555 |
| 189 | Ga0123353_12976598 | 3300010167 | Unclassified | 549 |
| 190 | Ga0123354_10157055 | 3300010882 | Bacteria | 2723 |
| 191 | Ga0466706_071389 | 3300042599 | Bacteria | 2005 |
| 192 | Ga0466713_135688 | 3300042602 | Bacteria | 4530 |
| 193 | JGI24703J35330_11056899 | 3300002501 | Unclassified | 664 |
| 194 | Ga0072940_1048502 | 3300005200 | Bacteria | 2825 |
| 195 | Ga0466697_277732 | 3300042611 | Bacteria | 1739 |
| 196 | Ga0466730_013756 | 3300042625 | Bacteria | 3313 |
| 197 | Ga0466730_030468 | 3300042625 | Unclassified | 1029 |
| 198 | Ga0466730_055029 | 3300042625 | Bacteria | 2380 |
| 199 | Ga0466727_095562 | 3300042655 | Bacteria | 3096 |
| 200 | Ga0466723_358333 | 3300042618 | Bacteria | 8657 |
| 201 | Ga0466726_340366 | 3300042619 | Bacteria | 3757 |
| 202 | Ga0466733_061981 | 3300042659 | Bacteria | 9950 |
| 203 | Ga0530661_007844 | 3300056564 | Bacteria | 3021 |
| 204 | Ga0160453_104031 | 3300012814 | Unclassified | 2820 |
| 205 | Ga0160440_100026 | 3300012815 | Bacteria | 257562 |
| 206 | Ga0160447_101487 | 3300012849 | Unclassified | 9077 |
| 207 | Ga0160430_111084 | 3300012852 | Bacteria | 1520 |
| 208 | Ga0160436_1008715 | 3300012861 | Bacteria | 2275 |
| 209 | Ga0466696_064794 | 3300042596 | Bacteria | 5075 |
| 210 | Ga0123357_10267010 | 3300009784 | Bacteria | 1796 |
| 211 | Ga0123355_11005154 | 3300009826 | Bacteria | 885 |
| 212 | Ga0123355_11537986 | 3300009826 | Bacteria | 646 |
| 213 | Ga0123356_10002108 | 3300010049 | Bacteria | 21445 |
| 214 | Ga0123356_10009447 | 3300010049 | Unclassified | 9624 |
| 215 | Ga0123356_10146011 | 3300010049 | Unclassified | 2340 |
| 216 | Ga0123353_10000728 | 3300010167 | Bacteria | 40136 |
| 217 | Ga0123353_10732507 | 3300010167 | Bacteria | 1380 |
| 218 | Ga0123353_13132903 | 3300010167 | Bacteria | 532 |
| 219 | Ga0123354_10008007 | 3300010882 | Bacteria | 16032 |
| 220 | Ga0123354_10576891 | 3300010882 | Bacteria | 835 |
| 221 | Ga0466713_103074 | 3300042602 | Bacteria | 8324 |
| 222 | Ga0466713_125507 | 3300042602 | Bacteria | 19997 |
| 223 | Ga0466714_022884 | 3300042603 | Bacteria | 3947 |
| 224 | AglaG_contig09291 | 2084038013 | Unclassified | 2624 |
| 225 | AustNasuHG_c1000578 | 3300000089 | Unclassified | 12918 |
| 226 | JGI24702J35022_10692476 | 3300002462 | Bacteria | 633 |
| 227 | JGI24705J35276_11827427 | 3300002504 | Unclassified | 700 |
| 228 | JGI24705J35276_12032204 | 3300002504 | Unclassified | 890 |
| 229 | JGI24705J35276_12099088 | 3300002504 | Bacteria | 1013 |
| 230 | JGI24699J35502_11131416 | 3300002509 | Bacteria | 5692 |
| 231 | JGI24699J35502_11133810 | 3300002509 | Bacteria | 16111 |
| 232 | Ga0068302_10265325 | 3300005071 | Unclassified | 1249 |
| 233 | Ga0466697_210286 | 3300042611 | Bacteria | 1083 |
| 234 | Ga0466730_013846 | 3300042625 | Unclassified | 19596 |
| 235 | Ga0466730_033803 | 3300042625 | Unclassified | 1469 |
| 236 | Ga0466730_035614 | 3300042625 | Bacteria | 1033 |
| 237 | Ga0466730_065956 | 3300042625 | Bacteria | 1848 |
| 238 | Ga0466703_047908 | 3300042636 | Bacteria | 12321 |
| 239 | Ga0466704_083296 | 3300042643 | Bacteria | 7332 |
| 240 | Ga0466727_013165 | 3300042655 | Bacteria | 10886 |
| 241 | Ga0466727_291795 | 3300042655 | Bacteria | 6591 |
| 242 | Ga0466726_419638 | 3300042619 | Bacteria | 3729 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10611 | DUF2469 | Protein of unknown function (DUF2469) | 23 | 121 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.