Protein Family IF10372
Metagenome
Isolate
159
Members
47
Samples
151
Scaffolds
610.46
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_210986|Ga0466733_210986_10462_12651
- Length
- 692 aa
- Sequence
- LPNCYQLIANLIVGVLPTVTAVLSLSKAKVSKINVILSFTFNCCVAVNTVSQLSININQPLTTFFEVFADLMYLCGLYDAKMISIEGLTVEFGGFTLLDGLSFVVNNKDRIALVGKNGAGKSTLLKILARMQAPTSGVVSIPKDTTIGYLPQQMQLSDKHTVREEAERAFEQIHLMEEEINRINTELAERTDYESEAFQKLIDRVTLLSEQFQMMGGTNYHAELERTLMGLGFTRDDFERPTSEFSGGWRMRIELAKLLLQRPDVLLLDEPTNHLDIESIQWLETFIATRANAVILVSHDRAFIDNTTIRTVEIELGKIYDYKVKYSDYVELRKERRAYENQQKKLADTEAFIERFRYKATKAVQVQSRIKSSALRLKFPPAPRSGSYPVITENLTKRYGDHLVFSGATFTIHRGDKVAFVGKNGEGKSTLVKCIMDEIDYQGTLTLGHNVKIGYFAQNQAQLLDENRTVFETIDYVAVGDVRTKIRDILGAFMFGGEASDKKVKVLSGGERSRLAMIRLLLEPVNLLILDEPTNHLDMRSKDVLKDALRDFDGTIIVVSHDREFLDGLVDKVYEFGNKQVKEHLGGIYEFLERKKIENLQELERKTTANMVSESTSQTIDTSXTSKLSYEEQKERSRVQRRLEKAITDSEQKIGASDTALYIEYEAAKKELSQTMDQWTEQTIELEEFGKD
Sample Types
Isolate
5.0%
Metagenome
95.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.8%
Termitidae
25.5%
Unclassified
21.3%
Termopsidae
8.5%
Rhinotermitidae
6.4%
Hodotermitidae
2.1%
Blattidae
2.1%
Passalidae
2.1%
Tenebrionidae
2.1%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 2 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 12 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 45 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_210986 | 3300042659 | Bacteria | 33448 |
| 2 | Ga0466715_083945 | 3300042616 | Bacteria | 14593 |
| 3 | Ga0466706_104552 | 3300042599 | Bacteria | 33608 |
| 4 | Ga0466700_386735 | 3300042600 | Bacteria | 4796 |
| 5 | Ga0466707_358950 | 3300042601 | Bacteria | 4483 |
| 6 | Ga0466719_050451 | 3300042606 | Bacteria | 8322 |
| 7 | Ga0466719_356059 | 3300042606 | Bacteria | 3578 |
| 8 | IMNBL1DRAFT_c0004303 | 3300000062 | Bacteria | 8607 |
| 9 | JGI24699J35502_11134168 | 3300002509 | Bacteria | 43545 |
| 10 | Ga0466703_433482 | 3300042636 | Bacteria | 8973 |
| 11 | Ga0466709_073410 | 3300042648 | Bacteria | 19111 |
| 12 | Ga0466708_367530 | 3300042652 | Bacteria | 33206 |
| 13 | Ga0466727_074149 | 3300042655 | Bacteria | 16026 |
| 14 | Ga0123353_10295130 | 3300010167 | Bacteria | 2479 |
| 15 | Ga0123354_10001155 | 3300010882 | Bacteria | 30901 |
| 16 | Ga0466690_002319 | 3300042590 | Bacteria | 19213 |
| 17 | Ga0466696_406078 | 3300042596 | Bacteria | 14164 |
| 18 | Ga0466697_247403 | 3300042611 | Bacteria | 2366 |
| 19 | Ga0466733_108606 | 3300042659 | Bacteria | 27573 |
| 20 | Ga0466733_185781 | 3300042659 | Bacteria | 4631 |
| 21 | Ga0466705_425387 | 3300042612 | Bacteria | 13913 |
| 22 | Ga0466705_475466 | 3300042612 | Bacteria | 8126 |
| 23 | Ga0466711_145802 | 3300042615 | Bacteria | 19674 |
| 24 | Ga0466711_152310 | 3300042615 | Bacteria | 29157 |
| 25 | Ga0466711_239934 | 3300042615 | Bacteria | 17196 |
| 26 | Ga0466707_287966 | 3300042601 | Bacteria | 4895 |
| 27 | Ga0466716_500320 | 3300042605 | Bacteria | 3598 |
| 28 | Ga0466722_267876 | 3300042609 | Bacteria | 7084 |
| 29 | Ga0068305_10452624 | 3300005083 | Unclassified | 10012 |
| 30 | Ga0466703_061210 | 3300042636 | Bacteria | 7420 |
| 31 | Ga0466692_103340 | 3300042591 | Bacteria | 5892 |
| 32 | Ga0466699_266864 | 3300042597 | Bacteria | 4432 |
| 33 | Ga0466733_010958 | 3300042659 | Bacteria | 12720 |
| 34 | Ga0466715_439245 | 3300042616 | Bacteria | 26781 |
| 35 | Ga0466715_604278 | 3300042616 | Bacteria | 10883 |
| 36 | Ga0466706_179279 | 3300042599 | Bacteria | 10325 |
| 37 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 38 | Ga0466714_112815 | 3300042603 | Bacteria | 3738 |
| 39 | Ga0466714_140426 | 3300042603 | Bacteria | 5048 |
| 40 | Ga0466719_177034 | 3300042606 | Bacteria | 4262 |
| 41 | Ga0466722_043134 | 3300042609 | Bacteria | 89421 |
| 42 | Ga0466722_238617 | 3300042609 | Bacteria | 3396 |
| 43 | IMNBL1DRAFT_c0002663 | 3300000062 | Bacteria | 12207 |
| 44 | JGI24702J35022_10011142 | 3300002462 | Bacteria | 5009 |
| 45 | JGI24702J35022_10019178 | 3300002462 | Bacteria | 3723 |
| 46 | Ga0466735_228473 | 3300042624 | Bacteria | 6604 |
| 47 | Ga0466704_066112 | 3300042643 | Bacteria | 10764 |
| 48 | Ga0466709_381353 | 3300042648 | Bacteria | 5595 |
| 49 | Ga0466708_236414 | 3300042652 | Bacteria | 7716 |
| 50 | Ga0466691_038170 | 3300042593 | Bacteria | 24327 |
| 51 | Ga0466733_044113 | 3300042659 | Bacteria | 6287 |
| 52 | Ga0466711_000212 | 3300042615 | Bacteria | 21541 |
| 53 | Ga0466715_458768 | 3300042616 | Bacteria | 71878 |
| 54 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 55 | Ga0466726_037804 | 3300042619 | Bacteria | 5661 |
| 56 | Ga0466726_048500 | 3300042619 | Bacteria | 17749 |
| 57 | Ga0466706_079043 | 3300042599 | Bacteria | 5088 |
| 58 | Ga0466706_252956 | 3300042599 | Bacteria | 3093 |
| 59 | Ga0466735_034042 | 3300042624 | Bacteria | 8965 |
| 60 | Ga0466703_032941 | 3300042636 | Bacteria | 6990 |
| 61 | Ga0466704_366289 | 3300042643 | Bacteria | 3636 |
| 62 | Ga0466704_416049 | 3300042643 | Bacteria | 2767 |
| 63 | Ga0466709_036824 | 3300042648 | Bacteria | 45300 |
| 64 | Ga0466709_178314 | 3300042648 | Bacteria | 4513 |
| 65 | Ga0466725_085561 | 3300042654 | Bacteria | 5900 |
| 66 | Ga0466690_037427 | 3300042590 | Bacteria | 19485 |
| 67 | Ga0466690_290671 | 3300042590 | Bacteria | 5102 |
| 68 | Ga0466696_157990 | 3300042596 | Bacteria | 15081 |
| 69 | Ga0466696_353358 | 3300042596 | Bacteria | 3392 |
| 70 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 71 | Ga0466711_008885 | 3300042615 | Bacteria | 6751 |
| 72 | Ga0466711_022010 | 3300042615 | Bacteria | 4790 |
| 73 | Ga0466715_233404 | 3300042616 | Bacteria | 7086 |
| 74 | Ga0466715_485052 | 3300042616 | Bacteria | 31199 |
| 75 | Ga0466726_023029 | 3300042619 | Bacteria | 2806 |
| 76 | Ga0466728_244432 | 3300042620 | Bacteria | 30862 |
| 77 | Ga0466707_007087 | 3300042601 | Bacteria | 4441 |
| 78 | Ga0466714_147194 | 3300042603 | Bacteria | 26228 |
| 79 | Ga0068302_10066918 | 3300005071 | Bacteria | 9116 |
| 80 | Ga0466735_057601 | 3300042624 | Bacteria | 5572 |
| 81 | Ga0466735_146418 | 3300042624 | Bacteria | 5047 |
| 82 | Ga0466703_063222 | 3300042636 | Bacteria | 8905 |
| 83 | Ga0466704_298975 | 3300042643 | Bacteria | 9913 |
| 84 | Ga0466704_381674 | 3300042643 | Bacteria | 10098 |
| 85 | Ga0466704_480992 | 3300042643 | Bacteria | 10100 |
| 86 | Ga0466727_037576 | 3300042655 | Bacteria | 6512 |
| 87 | Ga0466727_253072 | 3300042655 | Bacteria | 3764 |
| 88 | Ga0123356_10186957 | 3300010049 | Bacteria | 2099 |
| 89 | Ga0466690_100360 | 3300042590 | Bacteria | 7025 |
| 90 | Ga0466690_430393 | 3300042590 | Bacteria | 5144 |
| 91 | Ga0466691_045790 | 3300042593 | Bacteria | 2649 |
| 92 | Ga0466715_414673 | 3300042616 | Bacteria | 3322 |
| 93 | Ga0466723_030183 | 3300042618 | Bacteria | 23821 |
| 94 | Ga0466706_025945 | 3300042599 | Bacteria | 100859 |
| 95 | Ga0466706_132460 | 3300042599 | Bacteria | 45287 |
| 96 | Ga0466707_205111 | 3300042601 | Bacteria | 5465 |
| 97 | Ga0466713_012205 | 3300042602 | Bacteria | 14481 |
| 98 | Ga0466722_080425 | 3300042609 | Bacteria | 8406 |
| 99 | IMNBL1DRAFT_c0001741 | 3300000062 | Bacteria | 15965 |
| 100 | Ga0466703_166876 | 3300042636 | Bacteria | 14308 |
| 101 | Ga0466704_484825 | 3300042643 | Bacteria | 6099 |
| 102 | Ga0466709_208828 | 3300042648 | Bacteria | 4491 |
| 103 | Ga0466708_297652 | 3300042652 | Bacteria | 42408 |
| 104 | Ga0466727_057709 | 3300042655 | Bacteria | 2946 |
| 105 | Ga0123353_10208719 | 3300010167 | Bacteria | 3065 |
| 106 | Ga0466691_000897 | 3300042593 | Bacteria | 25654 |
| 107 | Ga0466691_011534 | 3300042593 | Bacteria | 26579 |
| 108 | Ga0466691_040831 | 3300042593 | Bacteria | 126917 |
| 109 | Ga0466696_062057 | 3300042596 | Bacteria | 26500 |
| 110 | Ga0466705_332215 | 3300042612 | Bacteria | 4473 |
| 111 | Ga0466715_079087 | 3300042616 | Bacteria | 12214 |
| 112 | Ga0466715_155144 | 3300042616 | Bacteria | 18435 |
| 113 | Ga0466715_438719 | 3300042616 | Bacteria | 10030 |
| 114 | Ga0466723_202994 | 3300042618 | Bacteria | 13808 |
| 115 | Ga0466728_006837 | 3300042620 | Bacteria | 8018 |
| 116 | Ga0466707_183787 | 3300042601 | Bacteria | 20164 |
| 117 | Ga0466707_211687 | 3300042601 | Bacteria | 38449 |
| 118 | Ga0466714_122509 | 3300042603 | Bacteria | 6883 |
| 119 | Ga0466716_029337 | 3300042605 | Bacteria | 6198 |
| 120 | Ga0466722_108041 | 3300042609 | Bacteria | 10352 |
| 121 | Ga0466722_266272 | 3300042609 | Bacteria | 29442 |
| 122 | Ga0466735_023376 | 3300042624 | Bacteria | 4824 |
| 123 | Ga0466703_062227 | 3300042636 | Bacteria | 19166 |
| 124 | Ga0466690_148842 | 3300042590 | Bacteria | 22929 |
| 125 | Ga0466705_098986 | 3300042612 | Bacteria | 5801 |
| 126 | Ga0466705_200604 | 3300042612 | Bacteria | 4640 |
| 127 | Ga0466705_315866 | 3300042612 | Bacteria | 12753 |
| 128 | Ga0466705_357345 | 3300042612 | Bacteria | 2663 |
| 129 | Ga0466723_188080 | 3300042618 | Bacteria | 4842 |
| 130 | Ga0466728_087702 | 3300042620 | Bacteria | 35663 |
| 131 | Ga0466729_031223 | 3300042621 | Bacteria | 18508 |
| 132 | Ga0466729_043865 | 3300042621 | Bacteria | 7686 |
| 133 | Ga0466706_104301 | 3300042599 | Bacteria | 25950 |
| 134 | Ga0466713_088520 | 3300042602 | Bacteria | 50636 |
| 135 | Ga0466713_140678 | 3300042602 | Bacteria | 25597 |
| 136 | Ga0466714_039543 | 3300042603 | Bacteria | 17731 |
| 137 | Ga0466716_323239 | 3300042605 | Bacteria | 8558 |
| 138 | Ga0068305_10005931 | 3300005083 | Bacteria | 20264 |
| 139 | Ga0466735_035764 | 3300042624 | Bacteria | 9305 |
| 140 | Ga0466703_322168 | 3300042636 | Bacteria | 8808 |
| 141 | Ga0466704_120143 | 3300042643 | Bacteria | 12402 |
| 142 | Ga0466708_361553 | 3300042652 | Bacteria | 11479 |
| 143 | Ga0466725_338069 | 3300042654 | Bacteria | 25558 |
| 144 | Ga0466727_093047 | 3300042655 | Bacteria | 16544 |
| 145 | Ga0123353_10002429 | 3300010167 | Bacteria | 23152 |
| 146 | Ga0466656_218598 | 3300042550 | Bacteria | 5858 |
| 147 | Ga0466690_017055 | 3300042590 | Bacteria | 17485 |
| 148 | Ga0466690_055481 | 3300042590 | Bacteria | 72316 |
| 149 | Ga0466696_113650 | 3300042596 | Bacteria | 3444 |
| 150 | Ga0466696_249490 | 3300042596 | Bacteria | 3155 |
| 151 | Ga0466696_345688 | 3300042596 | Bacteria | 17065 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.