Protein Family IF10327
Metagenome
Isolate
122
Members
47
Samples
115
Scaffolds
210.32
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_130577|Ga0466733_130577_13514_14284
- Length
- 244 aa
- Sequence
- MEVKKPKIKSIRYEEFNDNEYLENMVKELNANGTNVLIGVLDDVVNWGRSNSLWPLTFATSCCGIEYMAVGAARYDFARFGFEVTRASPRQADFIMVAGTITDKMAPVLKRLYDQMADPKYVIAIGACAVSGGPFKKSYHVVNGVDKILPVDVYVPGCPPRPEAMLYGIIQLQRKVKVEKFFGGVNKQVKNAEYERLMEEQSRLERQGCFDPEFLDGELHGCEPAIKGDLMTKPAEHEQDTGNK
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.0%
Kalotermitidae
27.7%
Unclassified
14.9%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Passalidae
4.3%
Blattidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 7 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 8 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 42 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 43 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_237599 | 3300042609 | Bacteria | 4902 |
| 2 | Ga0123356_10838245 | 3300010049 | Bacteria | 1091 |
| 3 | Ga0123353_10154635 | 3300010167 | Bacteria | 3658 |
| 4 | Ga0123353_10416902 | 3300010167 | Bacteria | 1991 |
| 5 | Ga0466692_063786 | 3300042591 | Bacteria | 32372 |
| 6 | Ga0466711_171443 | 3300042615 | Unclassified | 2271 |
| 7 | Ga0466715_176999 | 3300042616 | Bacteria | 6557 |
| 8 | Ga0466715_351050 | 3300042616 | Bacteria | 23393 |
| 9 | Ga0466728_183857 | 3300042620 | Bacteria | 4473 |
| 10 | Ga0466702_133169 | 3300042635 | Bacteria | 1099 |
| 11 | Ga0466709_245110 | 3300042648 | Bacteria | 22256 |
| 12 | Ga0466708_290083 | 3300042652 | Bacteria | 3901 |
| 13 | Ga0466727_021040 | 3300042655 | Bacteria | 7971 |
| 14 | Ga0466727_180639 | 3300042655 | Bacteria | 5143 |
| 15 | Ga0466727_334432 | 3300042655 | Bacteria | 3455 |
| 16 | Ga0466706_021075 | 3300042599 | Bacteria | 16026 |
| 17 | Ga0466700_032619 | 3300042600 | Bacteria | 5166 |
| 18 | Ga0466707_323672 | 3300042601 | Bacteria | 13232 |
| 19 | Ga0466716_371367 | 3300042605 | Bacteria | 12791 |
| 20 | Ga0466656_064781 | 3300042550 | Bacteria | 21643 |
| 21 | Ga0466694_172365 | 3300042594 | Bacteria | 5807 |
| 22 | Ga0466696_066752 | 3300042596 | Bacteria | 1918 |
| 23 | 2227548516 | 2225789004 | Bacteria | 2887 |
| 24 | Ga0466711_207811 | 3300042615 | Bacteria | 2195 |
| 25 | Ga0466711_427983 | 3300042615 | Unclassified | 1541 |
| 26 | Ga0466723_092051 | 3300042618 | Bacteria | 16294 |
| 27 | Ga0466726_481304 | 3300042619 | Bacteria | 2332 |
| 28 | Ga0466731_105697 | 3300042622 | Bacteria | 2851 |
| 29 | Ga0466707_075430 | 3300042601 | Bacteria | 1530 |
| 30 | Ga0466707_094849 | 3300042601 | Bacteria | 5976 |
| 31 | Ga0123354_10240708 | 3300010882 | Bacteria | 1862 |
| 32 | Ga0466690_005110 | 3300042590 | Bacteria | 14539 |
| 33 | 2227265259 | 2225789004 | Bacteria | 1290 |
| 34 | Ga0466715_403844 | 3300042616 | Bacteria | 18417 |
| 35 | Ga0466723_094954 | 3300042618 | Bacteria | 8294 |
| 36 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 37 | Ga0466731_428057 | 3300042622 | Unclassified | 1080 |
| 38 | Ga0466735_064452 | 3300042624 | Bacteria | 1315 |
| 39 | Ga0466735_100070 | 3300042624 | Bacteria | 6650 |
| 40 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 41 | Ga0466706_005003 | 3300042599 | Bacteria | 88622 |
| 42 | Ga0466707_093237 | 3300042601 | Bacteria | 19367 |
| 43 | Ga0466707_292031 | 3300042601 | Bacteria | 25024 |
| 44 | Ga0466707_359464 | 3300042601 | Bacteria | 15596 |
| 45 | Ga0466707_404068 | 3300042601 | Bacteria | 3494 |
| 46 | Ga0466719_388414 | 3300042606 | Bacteria | 11249 |
| 47 | Ga0123353_10073829 | 3300010167 | Bacteria | 5483 |
| 48 | 2227376385 | 2225789004 | Unclassified | 1105 |
| 49 | JGI24702J35022_10038789 | 3300002462 | Bacteria | 2543 |
| 50 | Ga0466729_148330 | 3300042621 | Bacteria | 4854 |
| 51 | Ga0466705_032844 | 3300042612 | Bacteria | 18355 |
| 52 | Ga0466735_008935 | 3300042624 | Bacteria | 1942 |
| 53 | Ga0466704_019741 | 3300042643 | Bacteria | 2133 |
| 54 | Ga0466709_231759 | 3300042648 | Bacteria | 5441 |
| 55 | Ga0466725_079292 | 3300042654 | Bacteria | 1335 |
| 56 | Ga0466706_283748 | 3300042599 | Bacteria | 2235 |
| 57 | Ga0466716_539568 | 3300042605 | Bacteria | 9234 |
| 58 | Ga0466719_012506 | 3300042606 | Bacteria | 11641 |
| 59 | Ga0466722_225350 | 3300042609 | Bacteria | 6032 |
| 60 | Ga0123353_10509141 | 3300010167 | Bacteria | 1751 |
| 61 | Ga0466696_115856 | 3300042596 | Bacteria | 3586 |
| 62 | Ga0466696_117540 | 3300042596 | Bacteria | 4651 |
| 63 | IMNBL1DRAFT_c0000105 | 3300000062 | Bacteria | 74361 |
| 64 | IMNBL1DRAFT_c0058719 | 3300000062 | Bacteria | 1167 |
| 65 | Ga0466705_111152 | 3300042612 | Bacteria | 15328 |
| 66 | Ga0466735_012272 | 3300042624 | Bacteria | 13363 |
| 67 | Ga0466735_108960 | 3300042624 | Bacteria | 1260 |
| 68 | Ga0466735_178283 | 3300042624 | Bacteria | 4947 |
| 69 | Ga0466703_275677 | 3300042636 | Bacteria | 16696 |
| 70 | Ga0466707_233145 | 3300042601 | Bacteria | 2121 |
| 71 | Ga0466713_083302 | 3300042602 | Bacteria | 19866 |
| 72 | Ga0466716_244511 | 3300042605 | Bacteria | 11044 |
| 73 | Ga0123357_10015964 | 3300009784 | Bacteria | 9862 |
| 74 | Ga0123356_10965447 | 3300010049 | Bacteria | 1023 |
| 75 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 76 | IMNBL1DRAFT_c0002877 | 3300000062 | Bacteria | 11540 |
| 77 | IMNBL1DRAFT_c0051029 | 3300000062 | Bacteria | 1306 |
| 78 | Ga0466711_008482 | 3300042615 | Bacteria | 9471 |
| 79 | Ga0466711_037672 | 3300042615 | Bacteria | 7262 |
| 80 | Ga0466711_091216 | 3300042615 | Bacteria | 7257 |
| 81 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 82 | Ga0466735_090278 | 3300042624 | Bacteria | 3196 |
| 83 | Ga0466703_167618 | 3300042636 | Bacteria | 10138 |
| 84 | Ga0466704_186597 | 3300042643 | Bacteria | 3823 |
| 85 | Ga0466704_396717 | 3300042643 | Bacteria | 26428 |
| 86 | Ga0466727_065684 | 3300042655 | Bacteria | 2505 |
| 87 | Ga0466727_167278 | 3300042655 | Bacteria | 64897 |
| 88 | Ga0466733_130577 | 3300042659 | Bacteria | 17591 |
| 89 | Ga0466716_264400 | 3300042605 | Bacteria | 2576 |
| 90 | Ga0466722_156750 | 3300042609 | Bacteria | 2042 |
| 91 | Ga0123356_10154068 | 3300010049 | Bacteria | 2286 |
| 92 | Ga0466692_139916 | 3300042591 | Bacteria | 4146 |
| 93 | Ga0466696_026812 | 3300042596 | Bacteria | 27611 |
| 94 | Ga0466696_151083 | 3300042596 | Bacteria | 1241 |
| 95 | Ga0466699_077001 | 3300042597 | Bacteria | 2469 |
| 96 | Ga0466715_028762 | 3300042616 | Bacteria | 3767 |
| 97 | Ga0466726_031616 | 3300042619 | Bacteria | 2295 |
| 98 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 99 | Ga0466705_293721 | 3300042612 | Unclassified | 1620 |
| 100 | Ga0466730_038353 | 3300042625 | Bacteria | 1383 |
| 101 | Ga0466704_243988 | 3300042643 | Bacteria | 3526 |
| 102 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 103 | Ga0466708_114504 | 3300042652 | Bacteria | 16711 |
| 104 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
| 105 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 106 | Ga0466701_098207 | 3300042598 | Bacteria | 13365 |
| 107 | Ga0466707_106706 | 3300042601 | Bacteria | 2240 |
| 108 | Ga0123353_11343793 | 3300010167 | Bacteria | 924 |
| 109 | Ga0466694_016389 | 3300042594 | Bacteria | 1415 |
| 110 | Ga0466696_286508 | 3300042596 | Bacteria | 7879 |
| 111 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 112 | Ga0123357_10002924 | 3300009784 | Bacteria | 19286 |
| 113 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 114 | Ga0466703_418314 | 3300042636 | Bacteria | 2434 |
| 115 | Ga0466704_142594 | 3300042643 | Bacteria | 6642 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01058 | Oxidored_q6 | NADH ubiquinone oxidoreductase, 20 Kd subunit | 62 | 172 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01058 | GO:0051536 | iron-sulfur cluster binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.