Protein Family IF10324
Metagenome
Isolate
297
Members
104
Samples
245
Scaffolds
441.9
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_118880|Ga0466733_118880_48377_49945
- Length
- 503 aa
- Sequence
- MSPDPKHTAKLLQELNLTVSYGKVNKVVGLVAEGTGLKAPLGSLCHILPQGFEQARRPGQAESKASEHTASNAGSQTDVIPVEVVGFREGNLLFMPYGDLRGVQPGSLIRNSSLPPFLPVGPGLLGRAFDAFGQPLEGLENILDANLAAAPVSDRTELAPIYADPPSPLSRPRIGEPLDVGVRSINSLLTLGKGQRVGIMAGSGVGKSTLMGMMARYTKADVNVIALIGERGREVLEFIEKDLGPEGIARSVLLVATSDQSPLVRMRAAYAGTAVAEYFRDQGKDVLFMMDSVTRFAMAAREVGLAVGEPPTTKGYTPSVFAQLPRLLERTGRNNKGTITGIYTVLVDGDDFNEPIADSVRSILDGHIVLTRELADQGHFPAIDVLRSISRLRADIVGKDEVNAGRAVIGSLAAYKKVEDMINIGAYAHGANAEIDRAIAIMPQINAFLRQDVGNPSNLEQSFAALRELGQAAGAQFDPVNSGGPNLAAKATAPAVGPNRQIR
Sample Types
Isolate
17.5%
Metagenome
82.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
37.6%
Termitidae
26.7%
Kalotermitidae
13.9%
Elmidae
5.0%
Rhinotermitidae
4.0%
Drosophilidae
2.0%
Passalidae
2.0%
Termopsidae
2.0%
Aphididae
1.0%
Scarabaeidae
1.0%
Tenebrionidae
1.0%
Hodotermitidae
1.0%
Formicidae
1.0%
Culicidae
1.0%
Penaeidae
1.0%
Taxonomy
Archaea
0
Bacteria
281
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 2 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 3 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 4 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 5 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 17 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 18 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 19 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 20 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 21 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 22 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 23 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 24 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 25 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 26 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 27 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 28 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 33 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 34 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 35 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 36 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 37 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 44 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 52 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 53 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 54 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 55 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 56 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 57 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 60 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 61 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 64 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 65 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 66 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 67 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 73 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 74 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 75 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 76 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 77 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 78 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 79 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 80 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 81 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 82 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 83 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 84 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 85 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 86 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 87 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 88 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 89 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 90 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 91 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 92 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 93 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 94 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 95 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 96 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 97 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 98 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 99 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 100 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 101 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 102 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 103 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 104 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_378770 | 3300042656 | Bacteria | 4650 |
| 2 | Ga0415639_008266 | 3300038395 | Bacteria | 91665 |
| 3 | Ga0466690_415601 | 3300042590 | Bacteria | 2031 |
| 4 | Ga0466693_133678 | 3300042592 | Bacteria | 2143 |
| 5 | Ga0466701_008777 | 3300042598 | Bacteria | 2776 |
| 6 | Ga0466706_084772 | 3300042599 | Bacteria | 36812 |
| 7 | Ga0466700_063771 | 3300042600 | Bacteria | 96209 |
| 8 | Ga0466713_103812 | 3300042602 | Bacteria | 226548 |
| 9 | Ga0466719_174480 | 3300042606 | Bacteria | 2965 |
| 10 | Ga0466721_309497 | 3300042608 | Bacteria | 27899 |
| 11 | Ga0123357_10077454 | 3300009784 | Bacteria | 4386 |
| 12 | Ga0123355_10014083 | 3300009826 | Bacteria | 12480 |
| 13 | Ga0123356_10003351 | 3300010049 | Bacteria | 16820 |
| 14 | Ga0123356_10007161 | 3300010049 | Bacteria | 11163 |
| 15 | Ga0123356_10037433 | 3300010049 | Bacteria | 4527 |
| 16 | Ga0123356_10064008 | 3300010049 | Bacteria | 3437 |
| 17 | Ga0123356_10066915 | 3300010049 | Bacteria | 3364 |
| 18 | Ga0123356_10116397 | 3300010049 | Bacteria | 2592 |
| 19 | Ga0123356_10326501 | 3300010049 | Bacteria | 1649 |
| 20 | Ga0123353_10215082 | 3300010167 | Unclassified | 3011 |
| 21 | Ga0123353_10401766 | 3300010167 | Bacteria | 2039 |
| 22 | Ga0123353_10403030 | 3300010167 | Bacteria | 2035 |
| 23 | Ga0466715_439779 | 3300042616 | Bacteria | 103620 |
| 24 | Ga0466704_070781 | 3300042643 | Bacteria | 7757 |
| 25 | 2212577970 | 2209111004 | Bacteria | 39599 |
| 26 | Ga0264413_107643 | 3300024493 | Unclassified | 14535 |
| 27 | Ga0466696_158524 | 3300042596 | Bacteria | 1876 |
| 28 | Ga0466719_037749 | 3300042606 | Bacteria | 13198 |
| 29 | Ga0123355_10000335 | 3300009826 | Bacteria | 61011 |
| 30 | Ga0123355_10000846 | 3300009826 | Bacteria | 42180 |
| 31 | Ga0123355_10000868 | 3300009826 | Bacteria | 41755 |
| 32 | Ga0123356_10000347 | 3300010049 | Bacteria | 53419 |
| 33 | Ga0123356_10002513 | 3300010049 | Bacteria | 19595 |
| 34 | Ga0123356_10006567 | 3300010049 | Unclassified | 11717 |
| 35 | Ga0123356_10013772 | 3300010049 | Bacteria | 7788 |
| 36 | Ga0123356_10022387 | 3300010049 | Bacteria | 5968 |
| 37 | Ga0123356_10032578 | 3300010049 | Bacteria | 4875 |
| 38 | Ga0123356_10103475 | 3300010049 | Bacteria | 2735 |
| 39 | Ga0123356_10325155 | 3300010049 | Bacteria | 1652 |
| 40 | Ga0123353_10088890 | 3300010167 | Bacteria | 4975 |
| 41 | Ga0123353_10126443 | 3300010167 | Bacteria | 4108 |
| 42 | Ga0123353_10352600 | 3300010167 | Bacteria | 2216 |
| 43 | Ga0466705_512578 | 3300042612 | Bacteria | 3417 |
| 44 | Ga0466711_113381 | 3300042615 | Bacteria | 4293 |
| 45 | Ga0466715_596654 | 3300042616 | Bacteria | 4940 |
| 46 | Ga0466702_109398 | 3300042635 | Unclassified | 2780 |
| 47 | Ga0466702_368103 | 3300042635 | Bacteria | 1814 |
| 48 | Ga0466703_046522 | 3300042636 | Unclassified | 35619 |
| 49 | Ga0466704_103379 | 3300042643 | Unclassified | 3441 |
| 50 | Ga0466708_012909 | 3300042652 | Bacteria | 42467 |
| 51 | Ga0466708_014893 | 3300042652 | Bacteria | 37946 |
| 52 | Ga0466727_160679 | 3300042655 | Bacteria | 27863 |
| 53 | JGI24695J34938_10000421 | 3300002450 | Bacteria | 41072 |
| 54 | JGI24695J34938_10008331 | 3300002450 | Bacteria | 5927 |
| 55 | Ga0466697_066362 | 3300042611 | Bacteria | 6184 |
| 56 | Ga0466705_030666 | 3300042612 | Bacteria | 33466 |
| 57 | Ga0466705_199448 | 3300042612 | Bacteria | 6289 |
| 58 | Ga0415639_019378 | 3300038395 | Bacteria | 13179 |
| 59 | Ga0415639_099611 | 3300038395 | Bacteria | 4769 |
| 60 | Ga0466693_120382 | 3300042592 | Bacteria | 1540 |
| 61 | Ga0466696_145382 | 3300042596 | Bacteria | 43883 |
| 62 | Ga0466700_118059 | 3300042600 | Bacteria | 2302 |
| 63 | Ga0466700_332942 | 3300042600 | Bacteria | 2208 |
| 64 | Ga0466707_175800 | 3300042601 | Unclassified | 4725 |
| 65 | Ga0466722_098890 | 3300042609 | Bacteria | 30657 |
| 66 | Ga0123356_10000200 | 3300010049 | Bacteria | 69462 |
| 67 | Ga0123356_10000987 | 3300010049 | Bacteria | 31617 |
| 68 | Ga0123356_10003135 | 3300010049 | Bacteria | 17420 |
| 69 | Ga0123356_10016959 | 3300010049 | Bacteria | 6937 |
| 70 | Ga0123356_10027602 | 3300010049 | Bacteria | 5319 |
| 71 | Ga0123356_10042433 | 3300010049 | Bacteria | 4238 |
| 72 | Ga0123356_10070576 | 3300010049 | Bacteria | 3277 |
| 73 | Ga0123356_10126257 | 3300010049 | Bacteria | 2498 |
| 74 | Ga0123353_10010599 | 3300010167 | Bacteria | 12867 |
| 75 | Ga0123353_10018016 | 3300010167 | Bacteria | 10420 |
| 76 | Ga0123353_10075285 | 3300010167 | Bacteria | 5425 |
| 77 | Ga0123353_10089132 | 3300010167 | Bacteria | 4967 |
| 78 | Ga0123353_10132040 | 3300010167 | Bacteria | 4006 |
| 79 | Ga0123353_10216794 | 3300010167 | Bacteria | 2997 |
| 80 | Ga0123353_10303867 | 3300010167 | Bacteria | 2433 |
| 81 | Ga0123354_10039856 | 3300010882 | Bacteria | 7275 |
| 82 | Ga0466730_051427 | 3300042625 | Bacteria | 8195 |
| 83 | Ga0466709_119653 | 3300042648 | Bacteria | 3655 |
| 84 | Ga0466709_393112 | 3300042648 | Bacteria | 2577 |
| 85 | Ga0466708_057254 | 3300042652 | Bacteria | 7251 |
| 86 | 2227557957 | 2225789004 | Bacteria | 14681 |
| 87 | Ga0072941_1094011 | 3300005201 | Bacteria | 5380 |
| 88 | Ga0466705_010833 | 3300042612 | Bacteria | 6949 |
| 89 | Ga0466705_369820 | 3300042612 | Bacteria | 8694 |
| 90 | Ga0466733_118880 | 3300042659 | Bacteria | 74217 |
| 91 | Ga0530661_000098 | 3300056564 | Bacteria | 81726 |
| 92 | Ga0160436_1000302 | 3300012861 | Bacteria | 21900 |
| 93 | Ga0415639_010437 | 3300038395 | Bacteria | 6612 |
| 94 | Ga0466692_202461 | 3300042591 | Bacteria | 20630 |
| 95 | Ga0466693_123567 | 3300042592 | Bacteria | 2333 |
| 96 | Ga0466694_157321 | 3300042594 | Bacteria | 7923 |
| 97 | Ga0466696_205874 | 3300042596 | Bacteria | 3858 |
| 98 | Ga0466707_216485 | 3300042601 | Bacteria | 10097 |
| 99 | Ga0466713_068665 | 3300042602 | Bacteria | 22225 |
| 100 | Ga0466722_233667 | 3300042609 | Bacteria | 8352 |
| 101 | Ga0123356_10019773 | 3300010049 | Bacteria | 6381 |
| 102 | Ga0123356_10109141 | 3300010049 | Bacteria | 2670 |
| 103 | Ga0123353_10000341 | 3300010167 | Bacteria | 56920 |
| 104 | Ga0123353_10001019 | 3300010167 | Bacteria | 34323 |
| 105 | Ga0123353_10001482 | 3300010167 | Bacteria | 28745 |
| 106 | Ga0123353_10179801 | 3300010167 | Bacteria | 3350 |
| 107 | Ga0123353_10210898 | 3300010167 | Bacteria | 3046 |
| 108 | Ga0123353_10265283 | 3300010167 | Bacteria | 2650 |
| 109 | Ga0123353_10291007 | 3300010167 | Bacteria | 2500 |
| 110 | Ga0123354_10017236 | 3300010882 | Bacteria | 11319 |
| 111 | Ga0466710_211219 | 3300042613 | Bacteria | 2339 |
| 112 | Ga0466715_137620 | 3300042616 | Bacteria | 33166 |
| 113 | Ga0466718_002139 | 3300042617 | Bacteria | 15032 |
| 114 | Ga0466729_296043 | 3300042621 | Bacteria | 74912 |
| 115 | Ga0466703_231667 | 3300042636 | Bacteria | 9400 |
| 116 | Ga0466703_394147 | 3300042636 | Bacteria | 3487 |
| 117 | Ga0466709_395413 | 3300042648 | Bacteria | 30012 |
| 118 | Ga0466708_112675 | 3300042652 | Bacteria | 5763 |
| 119 | IMNBL1DRAFT_c0002819 | 3300000062 | Bacteria | 11725 |
| 120 | JGI24702J35022_10001258 | 3300002462 | Bacteria | 15795 |
| 121 | Ga0466733_075826 | 3300042659 | Bacteria | 5468 |
| 122 | Ga0264413_146297 | 3300024493 | Bacteria | 5628 |
| 123 | Ga0415639_001669 | 3300038395 | Bacteria | 11867 |
| 124 | Ga0415639_007154 | 3300038395 | Bacteria | 45980 |
| 125 | Ga0466696_222248 | 3300042596 | Bacteria | 3118 |
| 126 | Ga0466707_405097 | 3300042601 | Bacteria | 42487 |
| 127 | Ga0466714_031869 | 3300042603 | Bacteria | 28020 |
| 128 | Ga0466719_202085 | 3300042606 | Unclassified | 1976 |
| 129 | Ga0466719_517844 | 3300042606 | Bacteria | 1962 |
| 130 | Ga0123355_10000494 | 3300009826 | Bacteria | 52434 |
| 131 | Ga0123355_10087693 | 3300009826 | Bacteria | 4944 |
| 132 | Ga0123355_10175108 | 3300009826 | Bacteria | 3197 |
| 133 | Ga0123356_10000168 | 3300010049 | Bacteria | 74133 |
| 134 | Ga0123356_10000206 | 3300010049 | Bacteria | 68602 |
| 135 | Ga0123356_10006296 | 3300010049 | Bacteria | 11987 |
| 136 | Ga0123356_10015080 | 3300010049 | Bacteria | 7411 |
| 137 | Ga0123356_10077665 | 3300010049 | Bacteria | 3132 |
| 138 | Ga0123353_10001897 | 3300010167 | Bacteria | 25689 |
| 139 | Ga0123353_10041641 | 3300010167 | Bacteria | 7258 |
| 140 | Ga0123353_10060842 | 3300010167 | Bacteria | 6055 |
| 141 | Ga0123353_10128586 | 3300010167 | Bacteria | 4068 |
| 142 | Ga0123353_10157787 | 3300010167 | Bacteria | 3614 |
| 143 | Ga0123353_10158563 | 3300010167 | Bacteria | 3604 |
| 144 | Ga0466705_505683 | 3300042612 | Bacteria | 150209 |
| 145 | Ga0466711_188190 | 3300042615 | Unclassified | 39886 |
| 146 | Ga0466718_089202 | 3300042617 | Bacteria | 2403 |
| 147 | Ga0466723_029754 | 3300042618 | Bacteria | 7829 |
| 148 | Ga0466723_344559 | 3300042618 | Bacteria | 2529 |
| 149 | Ga0466729_206567 | 3300042621 | Bacteria | 6034 |
| 150 | Ga0466703_153549 | 3300042636 | Unclassified | 3422 |
| 151 | Ga0466709_212346 | 3300042648 | Bacteria | 6271 |
| 152 | Ga0466708_020545 | 3300042652 | Bacteria | 23241 |
| 153 | Ga0466708_104035 | 3300042652 | Bacteria | 20831 |
| 154 | JGI24695J34938_10012798 | 3300002450 | Bacteria | 4432 |
| 155 | JGI24702J35022_10000034 | 3300002462 | Bacteria | 55908 |
| 156 | Ga0466705_038822 | 3300042612 | Bacteria | 45184 |
| 157 | Ga0466705_349488 | 3300042612 | Bacteria | 43585 |
| 158 | Ga0415639_066196 | 3300038395 | Bacteria | 1751 |
| 159 | Ga0466693_308454 | 3300042592 | Bacteria | 2732 |
| 160 | Ga0466694_057934 | 3300042594 | Bacteria | 8623 |
| 161 | Ga0466707_027131 | 3300042601 | Bacteria | 10317 |
| 162 | Ga0466707_396417 | 3300042601 | Bacteria | 2822 |
| 163 | Ga0123356_10335591 | 3300010049 | Bacteria | 1630 |
| 164 | Ga0123353_10001922 | 3300010167 | Bacteria | 25557 |
| 165 | Ga0123353_10093815 | 3300010167 | Bacteria | 4836 |
| 166 | Ga0123353_10136099 | 3300010167 | Bacteria | 3940 |
| 167 | Ga0123353_10611922 | 3300010167 | Bacteria | 1554 |
| 168 | Ga0123354_10086734 | 3300010882 | Bacteria | 4372 |
| 169 | Ga0466711_110869 | 3300042615 | Bacteria | 4276 |
| 170 | Ga0466715_010776 | 3300042616 | Bacteria | 6722 |
| 171 | Ga0466702_204986 | 3300042635 | Bacteria | 2390 |
| 172 | Ga0466703_187385 | 3300042636 | Bacteria | 4501 |
| 173 | Ga0466704_340265 | 3300042643 | Bacteria | 8945 |
| 174 | JGI24702J35022_10002987 | 3300002462 | Bacteria | 10236 |
| 175 | JGI24705J35276_12238481 | 3300002504 | Bacteria | 23648 |
| 176 | Ga0415639_001673 | 3300038395 | Bacteria | 103203 |
| 177 | Ga0415639_029714 | 3300038395 | Bacteria | 14350 |
| 178 | Ga0466692_197932 | 3300042591 | Bacteria | 3359 |
| 179 | Ga0466693_209866 | 3300042592 | Unclassified | 2067 |
| 180 | Ga0466691_010203 | 3300042593 | Bacteria | 4200 |
| 181 | Ga0466707_042182 | 3300042601 | Bacteria | 9417 |
| 182 | Ga0466707_393359 | 3300042601 | Bacteria | 13604 |
| 183 | Ga0466716_448891 | 3300042605 | Bacteria | 3955 |
| 184 | Ga0466719_142269 | 3300042606 | Bacteria | 7435 |
| 185 | Ga0466721_383877 | 3300042608 | Bacteria | 9927 |
| 186 | Ga0466722_003444 | 3300042609 | Bacteria | 3904 |
| 187 | Ga0466722_085971 | 3300042609 | Bacteria | 7035 |
| 188 | Ga0123356_10013307 | 3300010049 | Bacteria | 7950 |
| 189 | Ga0123356_10016358 | 3300010049 | Bacteria | 7078 |
| 190 | Ga0123356_10043936 | 3300010049 | Bacteria | 4160 |
| 191 | Ga0123356_10058799 | 3300010049 | Bacteria | 3586 |
| 192 | Ga0123356_10064098 | 3300010049 | Bacteria | 3435 |
| 193 | Ga0123353_10016375 | 3300010167 | Bacteria | 10836 |
| 194 | Ga0123353_10021477 | 3300010167 | Bacteria | 9692 |
| 195 | Ga0123353_10059573 | 3300010167 | Bacteria | 6123 |
| 196 | Ga0123353_10343235 | 3300010167 | Bacteria | 2254 |
| 197 | Ga0123353_10546353 | 3300010167 | Bacteria | 1672 |
| 198 | Ga0466711_122707 | 3300042615 | Bacteria | 10044 |
| 199 | Ga0466723_068981 | 3300042618 | Bacteria | 2837 |
| 200 | Ga0466723_073985 | 3300042618 | Bacteria | 19942 |
| 201 | Ga0466723_219643 | 3300042618 | Bacteria | 23371 |
| 202 | Ga0466735_055212 | 3300042624 | Bacteria | 2205 |
| 203 | Ga0466704_512425 | 3300042643 | Bacteria | 40327 |
| 204 | Ga0466704_602321 | 3300042643 | Bacteria | 12363 |
| 205 | Ga0466708_291672 | 3300042652 | Bacteria | 3635 |
| 206 | JGI24695J34938_10000100 | 3300002450 | Bacteria | 75497 |
| 207 | Ga0466705_010892 | 3300042612 | Bacteria | 6522 |
| 208 | Ga0466705_196400 | 3300042612 | Unclassified | 4254 |
| 209 | Ga0466706_145307 | 3300042599 | Bacteria | 3637 |
| 210 | Ga0466707_034738 | 3300042601 | Bacteria | 2509 |
| 211 | Ga0466707_227773 | 3300042601 | Bacteria | 15981 |
| 212 | Ga0466716_300598 | 3300042605 | Unclassified | 9624 |
| 213 | Ga0466720_076872 | 3300042607 | Bacteria | 2966 |
| 214 | Ga0466722_045774 | 3300042609 | Bacteria | 3656 |
| 215 | Ga0466722_260411 | 3300042609 | Bacteria | 75419 |
| 216 | Ga0123357_10100898 | 3300009784 | Bacteria | 3722 |
| 217 | Ga0123355_10177846 | 3300009826 | Bacteria | 3165 |
| 218 | Ga0123356_10005268 | 3300010049 | Bacteria | 13200 |
| 219 | Ga0123356_10008474 | 3300010049 | Bacteria | 10223 |
| 220 | Ga0123356_10017612 | 3300010049 | Bacteria | 6797 |
| 221 | Ga0123356_10098119 | 3300010049 | Bacteria | 2804 |
| 222 | Ga0123356_10136894 | 3300010049 | Bacteria | 2409 |
| 223 | Ga0123356_10171024 | 3300010049 | Unclassified | 2183 |
| 224 | Ga0123356_10171938 | 3300010049 | Bacteria | 2178 |
| 225 | Ga0123356_10195772 | 3300010049 | Bacteria | 2056 |
| 226 | Ga0123356_10223395 | 3300010049 | Bacteria | 1941 |
| 227 | Ga0123353_10033729 | 3300010167 | Bacteria | 7976 |
| 228 | Ga0123353_10037958 | 3300010167 | Bacteria | 7564 |
| 229 | Ga0123353_10075913 | 3300010167 | Bacteria | 5400 |
| 230 | Ga0123353_10080630 | 3300010167 | Bacteria | 5234 |
| 231 | Ga0123353_10118287 | 3300010167 | Bacteria | 4262 |
| 232 | Ga0123353_10181742 | 3300010167 | Bacteria | 3328 |
| 233 | Ga0123353_10244212 | 3300010167 | Bacteria | 2787 |
| 234 | Ga0123353_10252614 | 3300010167 | Bacteria | 2729 |
| 235 | Ga0123353_10333390 | 3300010167 | Bacteria | 2295 |
| 236 | Ga0466711_125816 | 3300042615 | Bacteria | 27796 |
| 237 | Ga0466711_255565 | 3300042615 | Bacteria | 1810 |
| 238 | Ga0466715_252621 | 3300042616 | Bacteria | 12566 |
| 239 | Ga0466723_012349 | 3300042618 | Unclassified | 12537 |
| 240 | Ga0466723_044181 | 3300042618 | Bacteria | 301962 |
| 241 | Ga0466723_301102 | 3300042618 | Bacteria | 8371 |
| 242 | Ga0466728_372282 | 3300042620 | Bacteria | 14644 |
| 243 | Ga0466729_095182 | 3300042621 | Bacteria | 1637 |
| 244 | Ga0466704_248188 | 3300042643 | Bacteria | 10529 |
| 245 | JGI24695J34938_10021502 | 3300002450 | Unclassified | 3154 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00006 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.