Protein Family IF10320

Metagenome Isolate
165 Members
54 Samples
153 Scaffolds
249.92 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_112100|Ga0466733_112100_30_917
Length
295 aa
Sequence
VQCGAGSQKKVRYSFGVTAPQVILLTASRIRLYNVLKGAFMISYHGTDANFSLEGKIAIITGGAAGIGNATAEFFAKKGVNLVLADLNPNVDAAAKKLGPKNIGVSGDVCNAAYRKSVIDAGVKTFGKIDILVNSAGIVALEKAEAISEDFWNRTININLTASFMMAQVFGAYLIENKSPGSIVNIASQAGVIALDKHVAYCASKGGIISMTQVLALEWGKYGIRVNCVSPTVVLTELGHKAWDGPAGDAFKKEVPAERFAEPDEIASVIAFLCSQNAAMITGHNLLIDGGYTIK

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.1%
Kalotermitidae 26.4%
Unclassified 15.1%
Blattidae 7.5%
Rhinotermitidae 5.7%
Termopsidae 5.7%
Passalidae 3.8%
Armadillidiidae 1.9%
Culicidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
6 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
19 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
20 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
23 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
28 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
29 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
34 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
48 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
49 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_108002 3300042656 Bacteria 31448
2 JGI24695J34938_10012402 3300002450 Bacteria 4517
3 Ga0466696_191067 3300042596 Bacteria 1731
4 Ga0123357_10048219 3300009784 Bacteria 5772
5 Ga0123357_10081083 3300009784 Bacteria 4266
6 Ga0123353_10358645 3300010167 Bacteria 2192
7 Ga0466723_038665 3300042618 Bacteria 29336
8 Ga0466726_318933 3300042619 Bacteria 1412
9 Ga0466707_276400 3300042601 Bacteria 6533
10 Ga0466707_292596 3300042601 Bacteria 1719
11 Ga0466707_304206 3300042601 Bacteria 2851
12 Ga0466707_386056 3300042601 Bacteria 2109
13 Ga0466716_000191 3300042605 Bacteria 6614
14 Ga0466703_004099 3300042636 Bacteria 5306
15 Ga0466703_243376 3300042636 Bacteria 14739
16 Ga0466704_096871 3300042643 Bacteria 30593
17 Ga0466709_254615 3300042648 Bacteria 7118
18 Ga0466708_237342 3300042652 Bacteria 8970
19 Ga0466705_197366 3300042612 Bacteria 5066
20 2227139141 2225789004 Bacteria 8783
21 Ga0466690_070119 3300042590 Bacteria 4702
22 Ga0466692_116369 3300042591 Bacteria 30494
23 Ga0466691_173707 3300042593 Bacteria 9649
24 Ga0466696_439212 3300042596 Bacteria 1307
25 Ga0466699_070629 3300042597 Bacteria 1961
26 Ga0466723_178056 3300042618 Bacteria 1063
27 Ga0466723_264635 3300042618 Bacteria 13376
28 Ga0466716_109516 3300042605 Bacteria 6486
29 Ga0466716_506423 3300042605 Bacteria 1660
30 Ga0466719_039952 3300042606 Bacteria 1367
31 Ga0466722_070400 3300042609 Bacteria 9716
32 Ga0466703_079544 3300042636 Bacteria 22016
33 Ga0466704_581384 3300042643 Bacteria 2123
34 Ga0466709_236554 3300042648 Bacteria 25875
35 Ga0466708_166567 3300042652 Unclassified 9027
36 Ga0466727_178478 3300042655 Bacteria 13656
37 Ga0466705_003217 3300042612 Bacteria 1342
38 Ga0466733_151573 3300042659 Bacteria 2463
39 Ga0466694_403587 3300042594 Bacteria 2357
40 Ga0466696_447669 3300042596 Bacteria 8481
41 Ga0123355_10146001 3300009826 Bacteria 3607
42 Ga0123356_10054229 3300010049 Bacteria 3734
43 Ga0123356_10064261 3300010049 Bacteria 3431
44 Ga0466711_423257 3300042615 Bacteria 16199
45 Ga0466715_166601 3300042616 Bacteria 13126
46 Ga0466723_335808 3300042618 Bacteria 17709
47 Ga0466728_244653 3300042620 Bacteria 23007
48 Ga0466714_133428 3300042603 Bacteria 1234
49 Ga0466716_334100 3300042605 Bacteria 6865
50 Ga0466722_197322 3300042609 Bacteria 3276
51 Ga0466703_170737 3300042636 Bacteria 1908
52 Ga0466703_297967 3300042636 Bacteria 2368
53 Ga0466703_337284 3300042636 Bacteria 10215
54 Ga0466709_024280 3300042648 Bacteria 10006
55 Ga0466727_165421 3300042655 Bacteria 1357
56 Ga0466733_030267 3300042659 Bacteria 2836
57 Ga0466733_039021 3300042659 Bacteria 1661
58 Ga0466733_094829 3300042659 Bacteria 1115
59 Ga0466691_111993 3300042593 Bacteria 26705
60 Ga0466696_135322 3300042596 Bacteria 6687
61 Ga0466696_341021 3300042596 Bacteria 2151
62 Ga0466715_423951 3300042616 Bacteria 3397
63 Ga0466726_336731 3300042619 Bacteria 1678
64 Ga0466728_108949 3300042620 Bacteria 7854
65 Ga0466728_226529 3300042620 Bacteria 7955
66 Ga0466729_165980 3300042621 Bacteria 4334
67 Ga0466720_109737 3300042607 Unclassified 3188
68 Ga0466722_217414 3300042609 Bacteria 1278
69 Ga0466735_030114 3300042624 Bacteria 1210
70 Ga0466703_002169 3300042636 Bacteria 1927
71 Ga0466703_206194 3300042636 Bacteria 1810
72 Ga0466709_275509 3300042648 Bacteria 18278
73 Ga0466705_078997 3300042612 Unclassified 8714
74 Ga0466705_358466 3300042612 Bacteria 28470
75 Ga0466733_112100 3300042659 Bacteria 1084
76 Ga0466733_159365 3300042659 Bacteria 1028
77 IMNBL1DRAFT_c0036189 3300000062 Bacteria 1727
78 Ga0466693_038556 3300042592 Bacteria 4343
79 Ga0466691_051253 3300042593 Bacteria 1864
80 Ga0466696_014778 3300042596 Bacteria 2221
81 Ga0123356_10046608 3300010049 Unclassified 4034
82 Ga0466705_513318 3300042612 Unclassified 2804
83 Ga0466711_203726 3300042615 Bacteria 10162
84 Ga0466723_072790 3300042618 Bacteria 4201
85 Ga0466723_129696 3300042618 Bacteria 10782
86 Ga0466723_300461 3300042618 Bacteria 2323
87 Ga0466726_374699 3300042619 Archaea 1613
88 Ga0466726_450643 3300042619 Bacteria 1404
89 Ga0466704_378199 3300042643 Bacteria 5754
90 Ga0466708_198459 3300042652 Bacteria 4031
91 Ga0466705_313083 3300042612 Bacteria 7575
92 Ga0466732_081567 3300042656 Bacteria 4000
93 Ga0466733_001606 3300042659 Bacteria 14315
94 Ga0466733_122961 3300042659 Unclassified 4160
95 Ga0466733_219806 3300042659 Bacteria 2341
96 JGI24700J35501_10930734 3300002508 Bacteria 20835
97 Ga0466690_357067 3300042590 Bacteria 6648
98 Ga0466691_015854 3300042593 Bacteria 6654
99 Ga0466691_224686 3300042593 Bacteria 13594
100 Ga0123353_10370030 3300010167 Bacteria 2149
101 Ga0466705_427665 3300042612 Bacteria 7925
102 Ga0466716_031134 3300042605 Bacteria 15582
103 Ga0466720_136664 3300042607 Bacteria 3252
104 Ga0466722_195548 3300042609 Bacteria 2436
105 Ga0466735_166722 3300042624 Bacteria 10307
106 Ga0466703_279892 3300042636 Bacteria 26432
107 Ga0466703_324943 3300042636 Bacteria 5739
108 Ga0466703_394316 3300042636 Bacteria 13173
109 Ga0466704_398294 3300042643 Bacteria 2631
110 Ga0466704_458544 3300042643 Bacteria 78073
111 Ga0466708_175549 3300042652 Bacteria 6408
112 Ga0466697_225052 3300042611 Bacteria 1456
113 Ga0074263_112815 3300005485 Unclassified 1160
114 Ga0160436_1008124 3300012861 Bacteria 2375
115 Ga0466693_188007 3300042592 Bacteria 12515
116 Ga0466691_040484 3300042593 Bacteria 10503
117 Ga0466691_146581 3300042593 Bacteria 2477
118 Ga0466696_172317 3300042596 Bacteria 3457
119 Ga0466696_386114 3300042596 Bacteria 10545
120 Ga0123354_10234552 3300010882 Bacteria 1907
121 Ga0123354_10302148 3300010882 Bacteria 1512
122 Ga0466728_012520 3300042620 Bacteria 5349
123 Ga0466719_050240 3300042606 Bacteria 4664
124 Ga0466719_387795 3300042606 Bacteria 4855
125 Ga0466720_009917 3300042607 Bacteria 21943
126 Ga0466720_133393 3300042607 Bacteria 3059
127 Ga0466722_109879 3300042609 Bacteria 6565
128 Ga0466722_229342 3300042609 Bacteria 6009
129 Ga0466735_089162 3300042624 Bacteria 3448
130 Ga0466704_159497 3300042643 Bacteria 4879
131 Ga0466709_205157 3300042648 Unclassified 2326
132 Ga0466708_282228 3300042652 Bacteria 5807
133 Ga0466727_105970 3300042655 Bacteria 2682
134 Ga0466727_214238 3300042655 Unclassified 2063
135 Ga0466733_025091 3300042659 Bacteria 1795
136 JGI24695J34938_10010346 3300002450 Bacteria 5114
137 Ga0160467_100073 3300012829 Bacteria 152393
138 Ga0264413_122697 3300024493 Bacteria 3627
139 Ga0466692_189215 3300042591 Bacteria 7065
140 Ga0466693_262730 3300042592 Bacteria 1202
141 Ga0123355_10045451 3300009826 Bacteria 7142
142 Ga0466711_159728 3300042615 Bacteria 10173
143 Ga0466711_364981 3300042615 Bacteria 4376
144 Ga0466715_101206 3300042616 Bacteria 7746
145 Ga0466723_154017 3300042618 Bacteria 8183
146 Ga0466726_470355 3300042619 Bacteria 2851
147 Ga0466728_079655 3300042620 Bacteria 6842
148 Ga0466713_113309 3300042602 Bacteria 5401
149 Ga0466704_183426 3300042643 Bacteria 5093
150 Ga0466704_197751 3300042643 Bacteria 17703
151 Ga0466709_065314 3300042648 Bacteria 14122
152 Ga0466727_292880 3300042655 Bacteria 5897
153 Ga0466727_312009 3300042655 Bacteria 4220

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_129696 Ga0466723_129696_5509_6276 230
2 3300042643 Ga0466704_197751 Ga0466704_197751_11887_12654 232
3 3300042596 Ga0466696_439212 Ga0466696_439212_138_905 234
4 3300042636 Ga0466703_004099 Ga0466703_004099_221_988 236
5 2225789004 2227139141 2227540256 237
6 3300042616 Ga0466715_101206 Ga0466715_101206_5453_6220 237
7 3300000062 IMNBL1DRAFT_c0036189 IMNBL1DRAFT_00361892 238
8 3300042612 Ga0466705_003217 Ga0466705_003217_126_893 238
9 3300042619 Ga0466726_318933 Ga0466726_318933_70_837 238
10 3300042624 Ga0466735_030114 Ga0466735_030114_346_1113 238
11 3300042624 Ga0466735_089162 Ga0466735_089162_1369_2136 238
12 3300042636 Ga0466703_079544 Ga0466703_079544_10137_10904 238
13 3300042636 Ga0466703_297967 Ga0466703_297967_705_1472 238
14 3300042636 Ga0466703_337284 Ga0466703_337284_4545_5312 238
15 3300042648 Ga0466709_024280 Ga0466709_024280_5701_6468 238
16 3300042591 Ga0466692_116369 Ga0466692_116369_19988_20755 239
17 3300042593 Ga0466691_015854 Ga0466691_015854_1536_2303 239
18 3300042606 Ga0466719_050240 Ga0466719_050240_827_1594 239
19 3300042615 Ga0466711_423257 Ga0466711_423257_12220_12987 239
20 3300042619 Ga0466726_450643 Ga0466726_450643_309_1076 239
21 3300042620 Ga0466728_012520 Ga0466728_012520_4325_5092 239
22 3300042620 Ga0466728_226529 Ga0466728_226529_2362_3129 239
23 3300042636 Ga0466703_170737 Ga0466703_170737_561_1328 239
24 3300042643 Ga0466704_183426 Ga0466704_183426_659_1426 239
25 3300042655 Ga0466727_165421 Ga0466727_165421_243_1010 239
26 3300010882 Ga0123354_10302148 Ga0123354_103021482 240
27 3300042596 Ga0466696_341021 Ga0466696_341021_408_1175 240
28 3300042602 Ga0466713_113309 Ga0466713_113309_3734_4501 240
29 3300042612 Ga0466705_427665 Ga0466705_427665_4742_5509 240
30 3300042612 Ga0466705_513318 Ga0466705_513318_1338_2105 240
31 3300042615 Ga0466711_364981 Ga0466711_364981_2096_2869 240
32 3300042636 Ga0466703_206194 Ga0466703_206194_358_1125 240
33 3300042643 Ga0466704_398294 Ga0466704_398294_1767_2534 240
34 3300042593 Ga0466691_040484 Ga0466691_040484_2893_3660 241
35 3300042605 Ga0466716_506423 Ga0466716_506423_755_1522 241
36 3300042612 Ga0466705_197366 Ga0466705_197366_550_1317 241
37 3300042615 Ga0466711_203726 Ga0466711_203726_8601_9371 241
38 3300042656 Ga0466732_108002 Ga0466732_108002_19044_19811 241
39 iso_pr_bacteria 2711768164 2712505537 241
40 iso_pr_bacteria 2816332503 2818126684 241
41 iso_pr_bacteria 2816332545 2818334453 241
42 3300012861 Ga0160436_1008124 Ga0160436_10081242 242
43 3300042590 Ga0466690_357067 Ga0466690_357067_5771_6538 242
44 3300042605 Ga0466716_000191 Ga0466716_000191_4296_5063 242
45 3300042605 Ga0466716_109516 Ga0466716_109516_448_1227 242
46 3300042655 Ga0466727_105970 Ga0466727_105970_681_1448 242
47 3300042596 Ga0466696_191067 Ga0466696_191067_410_1177 243
48 3300042596 Ga0466696_386114 Ga0466696_386114_2858_3625 243
49 3300042616 Ga0466715_423951 Ga0466715_423951_2366_3166 243
50 3300042596 Ga0466696_135322 Ga0466696_135322_4009_4776 244
51 3300042619 Ga0466726_470355 Ga0466726_470355_1998_2765 244
52 3300042643 Ga0466704_378199 Ga0466704_378199_4484_5251 244
53 3300042648 Ga0466709_236554 Ga0466709_236554_7364_8131 244
54 3300042648 Ga0466709_254615 Ga0466709_254615_4045_4812 244
55 3300042652 Ga0466708_198459 Ga0466708_198459_430_1197 244
56 3300042652 Ga0466708_237342 Ga0466708_237342_5535_6320 244
57 3300009784 Ga0123357_10048219 Ga0123357_100482192 245
58 3300042612 Ga0466705_078997 Ga0466705_078997_1996_2763 245
59 3300042620 Ga0466728_108949 Ga0466728_108949_4275_5042 245
60 3300042636 Ga0466703_324943 Ga0466703_324943_4948_5715 245
61 3300042659 Ga0466733_159365 Ga0466733_159365_136_903 245
62 3300002508 JGI24700J35501_10930734 JGI24700J35501_109307345 246
63 3300024493 Ga0264413_122697 Ga0264413_1226973 246
64 3300042590 Ga0466690_070119 Ga0466690_070119_1959_2726 246
65 3300042601 Ga0466707_386056 Ga0466707_386056_1078_1845 246
66 3300042612 Ga0466705_358466 Ga0466705_358466_16456_17223 246
67 3300042620 Ga0466728_079655 Ga0466728_079655_1259_2026 246
68 3300042643 Ga0466704_096871 Ga0466704_096871_15662_16429 246
69 3300042659 Ga0466733_001606 Ga0466733_001606_3451_4218 246
70 3300042592 Ga0466693_262730 Ga0466693_262730_57_824 247
71 3300042593 Ga0466691_146581 Ga0466691_146581_397_1164 247
72 3300042594 Ga0466694_403587 Ga0466694_403587_920_1687 247
73 3300042609 Ga0466722_217414 Ga0466722_217414_71_838 247
74 3300042619 Ga0466726_336731 Ga0466726_336731_447_1214 247
75 3300042636 Ga0466703_279892 Ga0466703_279892_9729_10496 247
76 3300042655 Ga0466727_178478 Ga0466727_178478_3253_4020 247
77 3300042655 Ga0466727_312009 Ga0466727_312009_1056_1823 247
78 3300042659 Ga0466733_025091 Ga0466733_025091_781_1548 247
79 3300042659 Ga0466733_094829 Ga0466733_094829_316_1083 247
80 3300042597 Ga0466699_070629 Ga0466699_070629_504_1271 248
81 3300042618 Ga0466723_335808 Ga0466723_335808_5241_6062 248
82 3300042648 Ga0466709_065314 Ga0466709_065314_6767_7534 248
83 3300042596 Ga0466696_172317 Ga0466696_172317_2114_2908 249
84 3300042606 Ga0466719_039952 Ga0466719_039952_280_1047 249
85 3300010049 Ga0123356_10064261 Ga0123356_100642613 250
86 3300042643 Ga0466704_159497 Ga0466704_159497_2520_3287 250
87 3300042618 Ga0466723_038665 Ga0466723_038665_6076_6909 252
88 3300042618 Ga0466723_072790 Ga0466723_072790_3213_4025 254
89 3300042659 Ga0466733_219806 Ga0466733_219806_738_1502 254
90 3300009826 Ga0123355_10045451 Ga0123355_100454513 255
91 3300042591 Ga0466692_189215 Ga0466692_189215_840_1607 255
92 3300042592 Ga0466693_188007 Ga0466693_188007_10155_10922 255
93 3300042593 Ga0466691_051253 Ga0466691_051253_574_1341 255
94 3300042593 Ga0466691_111993 Ga0466691_111993_5531_6298 255
95 3300042593 Ga0466691_173707 Ga0466691_173707_2524_3291 255
96 3300042593 Ga0466691_224686 Ga0466691_224686_5410_6177 255
97 3300042596 Ga0466696_014778 Ga0466696_014778_497_1264 255
98 3300042596 Ga0466696_447669 Ga0466696_447669_2575_3342 255
99 3300042601 Ga0466707_276400 Ga0466707_276400_759_1526 255
100 3300042601 Ga0466707_292596 Ga0466707_292596_738_1505 255
101 3300042601 Ga0466707_304206 Ga0466707_304206_99_866 255
102 3300042603 Ga0466714_133428 Ga0466714_133428_319_1086 255
103 3300042605 Ga0466716_031134 Ga0466716_031134_1237_2004 255
104 3300042606 Ga0466719_387795 Ga0466719_387795_1092_1859 255
105 3300042607 Ga0466720_009917 Ga0466720_009917_1271_2038 255
106 3300042607 Ga0466720_109737 Ga0466720_109737_2394_3161 255
107 3300042607 Ga0466720_133393 Ga0466720_133393_874_1641 255
108 3300042607 Ga0466720_136664 Ga0466720_136664_803_1570 255
109 3300042609 Ga0466722_109879 Ga0466722_109879_352_1119 255
110 3300042609 Ga0466722_195548 Ga0466722_195548_566_1333 255
111 3300042609 Ga0466722_197322 Ga0466722_197322_1426_2193 255
112 3300042609 Ga0466722_229342 Ga0466722_229342_4816_5583 255
113 3300042612 Ga0466705_313083 Ga0466705_313083_1919_2686 255
114 3300042616 Ga0466715_166601 Ga0466715_166601_11567_12334 255
115 3300042618 Ga0466723_154017 Ga0466723_154017_6215_6982 255
116 3300042618 Ga0466723_300461 Ga0466723_300461_189_956 255
117 3300042619 Ga0466726_374699 Ga0466726_374699_657_1424 255
118 3300042620 Ga0466728_244653 Ga0466728_244653_6686_7453 255
119 3300042621 Ga0466729_165980 Ga0466729_165980_2726_3493 255
120 3300042624 Ga0466735_166722 Ga0466735_166722_8433_9200 255
121 3300042636 Ga0466703_002169 Ga0466703_002169_325_1092 255
122 3300042636 Ga0466703_243376 Ga0466703_243376_5428_6195 255
123 3300042636 Ga0466703_394316 Ga0466703_394316_11299_12066 255
124 3300042648 Ga0466709_205157 Ga0466709_205157_337_1104 255
125 3300042652 Ga0466708_166567 Ga0466708_166567_6244_7011 255
126 3300042652 Ga0466708_175549 Ga0466708_175549_2133_2900 255
127 3300042652 Ga0466708_282228 Ga0466708_282228_2601_3368 255
128 3300042655 Ga0466727_214238 Ga0466727_214238_482_1249 255
129 3300042655 Ga0466727_292880 Ga0466727_292880_3222_3989 255
130 3300042656 Ga0466732_081567 Ga0466732_081567_2961_3728 255
131 3300042659 Ga0466733_039021 Ga0466733_039021_252_1019 255
132 iso_pr_bacteria 2529293168 2531453981 255
133 iso_pr_bacteria 2781125690 2781428524 255
134 iso_pr_bacteria 2819994798 2819997217 255
135 iso_pr_bacteria 2940264388 2940267121 255
136 iso_pr_bacteria 2940267548 2940270216 255
137 iso_pr_bacteria 2940270707 2940273462 255
138 iso_pr_bacteria 2940273867 2940276604 255
139 iso_pr_bacteria 650716099 650878092 255
140 iso_pr_bacteria 650716099 650879486 255
141 3300002450 JGI24695J34938_10010346 JGI24695J34938_100103465 256
142 3300002450 JGI24695J34938_10012402 JGI24695J34938_100124026 256
143 3300005485 Ga0074263_112815 Ga0074263_1128151 256
144 3300009784 Ga0123357_10081083 Ga0123357_100810832 256
145 3300009826 Ga0123355_10146001 Ga0123355_101460013 256
146 3300010049 Ga0123356_10046608 Ga0123356_100466084 256
147 3300010049 Ga0123356_10054229 Ga0123356_100542295 256
148 3300010167 Ga0123353_10358645 Ga0123353_103586452 256
149 3300010167 Ga0123353_10370030 Ga0123353_103700302 256
150 3300010882 Ga0123354_10234552 Ga0123354_102345522 256
151 3300042648 Ga0466709_275509 Ga0466709_275509_5307_6119 256
152 3300042592 Ga0466693_038556 Ga0466693_038556_2916_3695 259
153 3300042659 Ga0466733_122961 Ga0466733_122961_40_855 263
154 3300042609 Ga0466722_070400 Ga0466722_070400_6510_7304 264
155 3300042659 Ga0466733_151573 Ga0466733_151573_999_1793 264
156 3300042611 Ga0466697_225052 Ga0466697_225052_28_825 265
157 3300042659 Ga0466733_030267 Ga0466733_030267_1968_2813 265
158 3300042615 Ga0466711_159728 Ga0466711_159728_2740_3540 266
159 3300042605 Ga0466716_334100 Ga0466716_334100_5950_6765 271
160 3300012829 Ga0160467_100073 Ga0160467_100073118 273
161 3300042618 Ga0466723_178056 Ga0466723_178056_158_1042 278
162 3300042618 Ga0466723_264635 Ga0466723_264635_6474_7325 283
163 3300042643 Ga0466704_458544 Ga0466704_458544_15533_16387 284
164 3300042643 Ga0466704_581384 Ga0466704_581384_1137_2000 287
165 3300042659 Ga0466733_112100 Ga0466733_112100_30_917 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00106 adh_short short chain dehydrogenase 56 243 0.96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 63 293 0.95
PF08659 KR KR domain 59 204 0.88
PF23441 57 259 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.