Protein Family IF10311
Metagenome
Isolate
159
Members
48
Samples
153
Scaffolds
208.65
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_087057|Ga0466733_087057_1237_1980
- Length
- 247 aa
- Sequence
- MAKKYEVLDFWSLKAQKEGYPARSVYKLKEIDEKFKLIDVSRNTLFKVIDLGAAPGSWSLYVLRKFSGMTNQKNRCRATGFVGSVKEIDLGSNTFQNAAEQQGIRPSPTNKFLVSVDLSVLSRQHDKGLFDGENFFFMQGDITLAENRETLLSKGPFNLVISDAAPSTTGNRSVDTLRSLALVEEILVYAELGLAKGGNMVVKVFQGGDTASILKRMRELFTTAKSFKPEACRAESFETYYIGIDKK
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.8%
Kalotermitidae
23.9%
Unclassified
15.2%
Termopsidae
6.5%
Rhinotermitidae
6.5%
Taxonomy
Archaea
0
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 6 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 7 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 8 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 9 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 27 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_409095 | 3300042656 | Bacteria | 1581 |
| 2 | Ga0466733_183969 | 3300042659 | Bacteria | 2802 |
| 3 | Ga0466720_053382 | 3300042607 | Bacteria | 12344 |
| 4 | Ga0466720_070469 | 3300042607 | Bacteria | 2066 |
| 5 | Ga0123357_10239530 | 3300009784 | Bacteria | 1968 |
| 6 | Ga0123356_10001258 | 3300010049 | Bacteria | 28039 |
| 7 | Ga0123353_10666978 | 3300010167 | Bacteria | 1468 |
| 8 | Ga0466691_123947 | 3300042593 | Bacteria | 4064 |
| 9 | Ga0466703_194088 | 3300042636 | Bacteria | 13432 |
| 10 | Ga0466711_033997 | 3300042615 | Bacteria | 50799 |
| 11 | Ga0466718_040202 | 3300042617 | Bacteria | 12438 |
| 12 | Ga0466705_247055 | 3300042612 | Bacteria | 4570 |
| 13 | Ga0466732_002381 | 3300042656 | Bacteria | 23386 |
| 14 | Ga0466732_145373 | 3300042656 | Bacteria | 15408 |
| 15 | Ga0466732_378676 | 3300042656 | Bacteria | 1220 |
| 16 | Ga0466707_003441 | 3300042601 | Bacteria | 1495 |
| 17 | Ga0466716_156960 | 3300042605 | Unclassified | 4558 |
| 18 | Ga0466720_025402 | 3300042607 | Bacteria | 8771 |
| 19 | Ga0466720_133320 | 3300042607 | Bacteria | 1236 |
| 20 | Ga0466722_063265 | 3300042609 | Bacteria | 4125 |
| 21 | Ga0123355_10800676 | 3300009826 | Bacteria | 1051 |
| 22 | Ga0123353_10301030 | 3300010167 | Bacteria | 2448 |
| 23 | Ga0123353_10601206 | 3300010167 | Bacteria | 1572 |
| 24 | Ga0466692_111713 | 3300042591 | Bacteria | 1000 |
| 25 | Ga0466694_361094 | 3300042594 | Bacteria | 1985 |
| 26 | Ga0466699_082882 | 3300042597 | Bacteria | 3677 |
| 27 | Ga0466702_139840 | 3300042635 | Bacteria | 1284 |
| 28 | Ga0466727_020131 | 3300042655 | Bacteria | 9981 |
| 29 | Ga0072941_1132274 | 3300005201 | Bacteria | 1708 |
| 30 | Ga0466711_207898 | 3300042615 | Bacteria | 12580 |
| 31 | Ga0466715_205733 | 3300042616 | Bacteria | 13301 |
| 32 | Ga0466697_199453 | 3300042611 | Bacteria | 1089 |
| 33 | Ga0466733_137022 | 3300042659 | Bacteria | 1403 |
| 34 | Ga0466719_212487 | 3300042606 | Bacteria | 5318 |
| 35 | Ga0466720_012939 | 3300042607 | Bacteria | 2750 |
| 36 | Ga0466720_073608 | 3300042607 | Bacteria | 4615 |
| 37 | Ga0466720_084569 | 3300042607 | Bacteria | 1143 |
| 38 | Ga0466720_100041 | 3300042607 | Bacteria | 3456 |
| 39 | Ga0466720_122537 | 3300042607 | Bacteria | 27632 |
| 40 | Ga0466720_219822 | 3300042607 | Bacteria | 1333 |
| 41 | Ga0123353_10068446 | 3300010167 | Bacteria | 5701 |
| 42 | Ga0123353_10572945 | 3300010167 | Bacteria | 1622 |
| 43 | Ga0264413_113394 | 3300024493 | Bacteria | 24952 |
| 44 | Ga0415639_001412 | 3300038395 | Bacteria | 14488 |
| 45 | Ga0466692_057276 | 3300042591 | Bacteria | 16369 |
| 46 | Ga0466694_342337 | 3300042594 | Bacteria | 3953 |
| 47 | Ga0466702_124742 | 3300042635 | Bacteria | 24190 |
| 48 | Ga0466709_036843 | 3300042648 | Bacteria | 15903 |
| 49 | JGI24702J35022_10000386 | 3300002462 | Bacteria | 26219 |
| 50 | Ga0466711_352574 | 3300042615 | Bacteria | 7834 |
| 51 | Ga0466723_173498 | 3300042618 | Bacteria | 7991 |
| 52 | Ga0466723_199520 | 3300042618 | Bacteria | 34473 |
| 53 | Ga0466726_436624 | 3300042619 | Bacteria | 2262 |
| 54 | Ga0466732_450785 | 3300042656 | Bacteria | 1803 |
| 55 | Ga0466733_087057 | 3300042659 | Bacteria | 3548 |
| 56 | Ga0264413_110654 | 3300024493 | Bacteria | 9317 |
| 57 | Ga0415639_082996 | 3300038395 | Bacteria | 2431 |
| 58 | Ga0456237_0008936 | 3300041968 | Bacteria | 1501 |
| 59 | Ga0456237_0024578 | 3300041968 | Bacteria | 822 |
| 60 | Ga0466727_049977 | 3300042655 | Bacteria | 1797 |
| 61 | Ga0466727_197768 | 3300042655 | Bacteria | 1278 |
| 62 | JGI24695J34938_10000125 | 3300002450 | Bacteria | 68505 |
| 63 | JGI24695J34938_10015380 | 3300002450 | Bacteria | 3927 |
| 64 | JGI24702J35022_10000772 | 3300002462 | Bacteria | 19865 |
| 65 | Ga0072940_1088921 | 3300005200 | Bacteria | 1356 |
| 66 | Ga0074263_103175 | 3300005485 | Bacteria | 2831 |
| 67 | Ga0466718_060382 | 3300042617 | Bacteria | 12767 |
| 68 | Ga0466707_404044 | 3300042601 | Bacteria | 1465 |
| 69 | Ga0466716_009777 | 3300042605 | Bacteria | 4395 |
| 70 | Ga0466720_014550 | 3300042607 | Bacteria | 6014 |
| 71 | Ga0466720_015075 | 3300042607 | Bacteria | 1397 |
| 72 | Ga0466720_228829 | 3300042607 | Bacteria | 1744 |
| 73 | Ga0123355_11134420 | 3300009826 | Bacteria | 808 |
| 74 | Ga0123356_10303751 | 3300010049 | Bacteria | 1702 |
| 75 | Ga0123353_10523176 | 3300010167 | Bacteria | 1720 |
| 76 | Ga0123353_10575087 | 3300010167 | Bacteria | 1618 |
| 77 | Ga0264413_130655 | 3300024493 | Bacteria | 7186 |
| 78 | Ga0466692_203504 | 3300042591 | Bacteria | 37281 |
| 79 | Ga0466691_084312 | 3300042593 | Bacteria | 44635 |
| 80 | Ga0466694_034765 | 3300042594 | Bacteria | 1506 |
| 81 | Ga0466709_113678 | 3300042648 | Bacteria | 5075 |
| 82 | AustNasuHG_c1002311 | 3300000089 | Bacteria | 6880 |
| 83 | JGI24698J34947_10070991 | 3300002449 | Bacteria | 1673 |
| 84 | JGI24695J34938_10001447 | 3300002450 | Bacteria | 20108 |
| 85 | JGI24695J34938_10004181 | 3300002450 | Bacteria | 9609 |
| 86 | Ga0466718_002820 | 3300042617 | Bacteria | 3279 |
| 87 | Ga0466726_040601 | 3300042619 | Bacteria | 8795 |
| 88 | Ga0466726_103376 | 3300042619 | Bacteria | 11813 |
| 89 | Ga0466733_028591 | 3300042659 | Bacteria | 15203 |
| 90 | Ga0466733_180037 | 3300042659 | Bacteria | 2039 |
| 91 | Ga0466719_480627 | 3300042606 | Bacteria | 1539 |
| 92 | Ga0466720_010141 | 3300042607 | Bacteria | 21220 |
| 93 | Ga0466720_074886 | 3300042607 | Bacteria | 13275 |
| 94 | Ga0466720_143499 | 3300042607 | Bacteria | 10972 |
| 95 | Ga0466720_159376 | 3300042607 | Bacteria | 1618 |
| 96 | Ga0466720_219584 | 3300042607 | Bacteria | 92443 |
| 97 | Ga0466720_235439 | 3300042607 | Bacteria | 29502 |
| 98 | Ga0123357_10045875 | 3300009784 | Bacteria | 5927 |
| 99 | Ga0264413_109283 | 3300024493 | Bacteria | 11739 |
| 100 | Ga0264413_112401 | 3300024493 | Bacteria | 4766 |
| 101 | Ga0264413_117212 | 3300024493 | Bacteria | 13806 |
| 102 | Ga0415639_096736 | 3300038395 | Bacteria | 2028 |
| 103 | Ga0456237_0001979 | 3300041968 | Unclassified | 3309 |
| 104 | Ga0466694_026871 | 3300042594 | Bacteria | 1411 |
| 105 | Ga0466694_133446 | 3300042594 | Bacteria | 4961 |
| 106 | Ga0466704_203834 | 3300042643 | Bacteria | 46255 |
| 107 | Ga0466708_012478 | 3300042652 | Bacteria | 12854 |
| 108 | AustNasuHG_c1003357 | 3300000089 | Bacteria | 5783 |
| 109 | JGI24698J34947_10001808 | 3300002449 | Bacteria | 11412 |
| 110 | Ga0466718_119888 | 3300042617 | Bacteria | 30418 |
| 111 | Ga0466723_024065 | 3300042618 | Bacteria | 2767 |
| 112 | Ga0466723_348481 | 3300042618 | Bacteria | 3131 |
| 113 | Ga0466726_069771 | 3300042619 | Bacteria | 1603 |
| 114 | Ga0466733_150492 | 3300042659 | Bacteria | 9712 |
| 115 | Ga0466700_284112 | 3300042600 | Bacteria | 1418 |
| 116 | Ga0466707_327175 | 3300042601 | Bacteria | 1667 |
| 117 | Ga0466720_047617 | 3300042607 | Bacteria | 1468 |
| 118 | Ga0466720_211957 | 3300042607 | Bacteria | 2823 |
| 119 | Ga0123353_10040621 | 3300010167 | Bacteria | 7341 |
| 120 | Ga0123353_10141877 | 3300010167 | Bacteria | 3847 |
| 121 | Ga0123353_10764843 | 3300010167 | Bacteria | 1341 |
| 122 | Ga0123353_10880997 | 3300010167 | Bacteria | 1222 |
| 123 | Ga0123353_11409503 | 3300010167 | Bacteria | 895 |
| 124 | Ga0123353_12290011 | 3300010167 | Bacteria | 650 |
| 125 | Ga0264413_128175 | 3300024493 | Bacteria | 2858 |
| 126 | Ga0466692_130511 | 3300042591 | Bacteria | 22226 |
| 127 | Ga0466703_269341 | 3300042636 | Bacteria | 3887 |
| 128 | Ga0466708_135847 | 3300042652 | Bacteria | 21940 |
| 129 | Ga0466708_258351 | 3300042652 | Bacteria | 4832 |
| 130 | AustNasuHG_c1000384 | 3300000089 | Bacteria | 15338 |
| 131 | Ga0074263_126512 | 3300005485 | Bacteria | 802 |
| 132 | Ga0466718_104716 | 3300042617 | Unclassified | 3465 |
| 133 | Ga0466732_125472 | 3300042656 | Bacteria | 1495 |
| 134 | Ga0466733_022862 | 3300042659 | Bacteria | 17235 |
| 135 | Ga0466700_068448 | 3300042600 | Bacteria | 6503 |
| 136 | Ga0466714_087542 | 3300042603 | Bacteria | 1544 |
| 137 | Ga0123353_10344777 | 3300010167 | Bacteria | 2248 |
| 138 | Ga0466692_086813 | 3300042591 | Bacteria | 12592 |
| 139 | Ga0466694_022535 | 3300042594 | Bacteria | 2133 |
| 140 | Ga0466694_069710 | 3300042594 | Bacteria | 1536 |
| 141 | Ga0466694_323205 | 3300042594 | Unclassified | 1024 |
| 142 | Ga0466694_379813 | 3300042594 | Bacteria | 3194 |
| 143 | Ga0466731_316175 | 3300042622 | Bacteria | 1747 |
| 144 | Ga0466735_218024 | 3300042624 | Bacteria | 1403 |
| 145 | Ga0466702_429467 | 3300042635 | Bacteria | 1150 |
| 146 | Ga0466703_109633 | 3300042636 | Bacteria | 3347 |
| 147 | JGI24698J34947_10004614 | 3300002449 | Unclassified | 7510 |
| 148 | Ga0072940_1004261 | 3300005200 | Bacteria | 1975 |
| 149 | Ga0072941_1012431 | 3300005201 | Bacteria | 4566 |
| 150 | Ga0072941_1013348 | 3300005201 | Bacteria | 7061 |
| 151 | Ga0466715_150227 | 3300042616 | Bacteria | 4927 |
| 152 | Ga0466718_014225 | 3300042617 | Bacteria | 3133 |
| 153 | Ga0466718_131334 | 3300042617 | Bacteria | 1274 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01728 | FtsJ | FtsJ-like methyltransferase | 20 | 245 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.