Protein Family IF10297

Metagenome Isolate
127 Members
85 Samples
94 Scaffolds
212.17 Avg Length

🧬 Representative Sequence

ID
3300042659|Ga0466733_061644|Ga0466733_061644_1022_1693
Length
223 aa
Sequence
MMFFPTFVLLFYKKTMETAKKIAQSLLQIKAIKLSPASPFTWASGWKSPIYCDNRKTLAYPAVRRQIAEAFAQLVKSKYPDVEVIAGVATGAIAHGLLVAEQLNLPFVYVRAKPKEHGLGNQIEGELPPNKKVVVEDLISTGGSSLSALAALRAAQANVLGMVAIFTYGFATAQRNFAEAACELTTLSDYAALIDEAAASGYVQPADIEVLKQWREAPDRWGA

📊 Sample Types

Isolate 26.0%
Metagenome 74.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.6%
Unclassified 17.1%
Apidae 11.0%
Kalotermitidae 11.0%
Formicidae 8.5%
Tenebrionidae 4.9%
Drosophilidae 4.9%
Rhinotermitidae 2.4%
Culicidae 2.4%
Blattidae 2.4%
Elmidae 2.4%
Nephropidae 1.2%
Hodotermitidae 1.2%
Scarabaeidae 1.2%
Passalidae 1.2%
Cambaridae 1.2%
Kiwaidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
3 2904728850 Flavobacterium sp. xlx-214 Isolate
4 2595698199 Melissococcus plutonius 60 Isolate Apidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 8007237282 Enterococcus sp. DIV0212c Isolate
10 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
14 2595698197 Melissococcus plutonius H6 Isolate Apidae
15 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
16 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
17 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
18 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
19 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
20 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
25 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
26 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
27 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
28 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
31 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
35 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
36 2595698193 Melissococcus plutonius B5 Isolate Apidae
37 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
38 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
39 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
40 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
41 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
42 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
43 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
44 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
45 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
46 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
47 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
48 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
49 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
52 2595698195 Melissococcus plutonius 119 Isolate Apidae
53 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
56 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
59 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
60 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
61 2864836148 Arcicella rosea S00070 Isolate Elmidae
62 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
63 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
64 2627853628 Melissococcus plutonius 82 Isolate Apidae
65 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
66 2595698198 Melissococcus plutonius L9 Isolate Apidae
67 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
68 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
69 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
70 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
71 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
72 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
73 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
74 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
75 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
76 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
77 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
78 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
79 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
80 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
81 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
82 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
83 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
84 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
85 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0102739_1000221 3300007095 Bacteria 14214
2 Ga0103268_1000186 3300007192 Bacteria 20581
3 Ga0105005_1028880 3300007505 Bacteria 7845
4 Ga0466691_082749 3300042593 Bacteria 46713
5 Ga0123356_10647030 3300010049 Bacteria 1224
6 Ga0123353_10145561 3300010167 Bacteria 3789
7 Ga0123353_10221315 3300010167 Unclassified 2959
8 Ga0123353_10485399 3300010167 Bacteria 1806
9 Ga0123353_10842340 3300010167 Bacteria 1258
10 Ga0123354_10220136 3300010882 Bacteria 2020
11 Ga0160465_100082 3300012803 Bacteria 102558
12 Ga0466700_488171 3300042600 Bacteria 10749
13 Ga0466713_064041 3300042602 Bacteria 54434
14 Ga0466714_037898 3300042603 Bacteria 6816
15 Ga0466714_145083 3300042603 Bacteria 1469
16 Ga0466710_268928 3300042613 Bacteria 1987
17 Ga0102735_1000097 3300007080 Bacteria 23143
18 Ga0466704_170690 3300042643 Bacteria 24896
19 Ga0466690_127286 3300042590 Bacteria 8800
20 Ga0466694_373637 3300042594 Bacteria 3091
21 Ga0466707_336175 3300042601 Bacteria 1655
22 Ga0466714_133787 3300042603 Bacteria 32286
23 Ga0466697_249131 3300042611 Bacteria 1623
24 Ga0466732_164694 3300042656 Bacteria 2109
25 Ga0562375_0192 3300056856 Bacteria 174214
26 Ga0466715_009406 3300042616 Bacteria 67720
27 IMNBL1DRAFT_c0029429 3300000062 Unclassified 2032
28 JGI24696J40584_12955396 3300002834 Bacteria 2825
29 Ga0103267_1000171 3300007190 Bacteria 25713
30 Ga0466734_087496 3300042623 Bacteria 2097
31 Ga0466704_603465 3300042643 Bacteria 44293
32 Ga0466701_017057 3300042598 Bacteria 176601
33 Ga0466722_142532 3300042609 Bacteria 7234
34 Ga0466705_119618 3300042612 Bacteria 2074
35 Ga0466732_442182 3300042656 Bacteria 64629
36 Ga0466733_161336 3300042659 Bacteria 23619
37 Ga0466710_422871 3300042613 Bacteria 5669
38 Ga0466712_017223 3300042614 Bacteria 1233
39 Ga0466723_153709 3300042618 Bacteria 20208
40 Ga0466729_135818 3300042621 Bacteria 1704
41 IMNBL1DRAFT_c0043111 3300000062 Bacteria 1496
42 Ga0102737_1000070 3300007142 Bacteria 41738
43 Ga0157631_132683 3300013007 Bacteria 3390
44 Ga0466699_137546 3300042597 Bacteria 1467
45 Ga0466706_012634 3300042599 Bacteria 153886
46 Ga0466713_107127 3300042602 Bacteria 6738
47 Ga0466714_132520 3300042603 Bacteria 10174
48 Ga0466705_005384 3300042612 Bacteria 3044
49 Ga0530661_001047 3300056564 Bacteria 16033
50 IMNBL1DRAFT_c0031694 3300000062 Bacteria 1918
51 JGI24705J35276_12188745 3300002504 Bacteria 1444
52 Ga0103267_1000002 3300007190 Bacteria 110962
53 Ga0466657_031632 3300042582 Bacteria 26143
54 Ga0123353_11608049 3300010167 Bacteria 820
55 Ga0466706_180930 3300042599 Bacteria 10727
56 Ga0466707_285977 3300042601 Bacteria 27691
57 Ga0466714_022983 3300042603 Bacteria 5382
58 Ga0562375_0195 3300056856 Bacteria 172233
59 Ga0466723_274502 3300042618 Bacteria 11886
60 Ga0466728_471444 3300042620 Bacteria 2864
61 Ga0103267_1000764 3300007190 Bacteria 12862
62 Ga0160434_100028 3300012850 Bacteria 130139
63 Ga0466657_299798 3300042582 Bacteria 1853
64 Ga0466693_370534 3300042592 Bacteria 1480
65 Ga0123355_10000052 3300009826 Bacteria 119479
66 Ga0123353_10000267 3300010167 Bacteria 65336
67 Ga0466706_218545 3300042599 Bacteria 35347
68 Ga0466707_420205 3300042601 Bacteria 47782
69 Ga0466713_059567 3300042602 Bacteria 80935
70 Ga0466705_371880 3300042612 Bacteria 5410
71 Ga0466733_155914 3300042659 Bacteria 12147
72 Ga0466733_217830 3300042659 Bacteria 1148
73 Ga0530661_000001 3300056564 Bacteria 684835
74 IMNBL1DRAFT_c0049307 3300000062 Unclassified 1344
75 JGI24702J35022_10000040 3300002462 Bacteria 53566
76 JGI24705J35276_12229971 3300002504 Bacteria 3508
77 Ga0074311_1145852 3300005317 Bacteria 1273
78 Ga0104045_1005210 3300007085 Bacteria 2634
79 Ga0102740_1000138 3300007140 Bacteria 24816
80 Ga0466704_165712 3300042643 Bacteria 4826
81 Ga0466693_224980 3300042592 Bacteria 3939
82 Ga0466696_026007 3300042596 Bacteria 8120
83 Ga0123355_10020024 3300009826 Bacteria 10670
84 Ga0123353_10398570 3300010167 Bacteria 2049
85 Ga0466706_256684 3300042599 Bacteria 1439
86 Ga0466733_061644 3300042659 Bacteria 2843
87 Ga0562379_0401 3300056790 Bacteria 96535
88 Ga0103267_1001959 3300007190 Bacteria 5862
89 Ga0466703_077747 3300042636 Bacteria 3509
90 Ga0466724_68743 3300042649 Bacteria 337166
91 Ga0160448_112977 3300012854 Bacteria 1608
92 Ga0123353_10054230 3300010167 Bacteria 6410
93 Ga0466706_130683 3300042599 Bacteria 28902
94 Ga0466700_335764 3300042600 Bacteria 1067

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00156 Pribosyltran Phosphoribosyl transferase domain 60 166 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.