Protein Family IF10291
Metagenome
Isolate
277
Members
167
Samples
180
Scaffolds
198.71
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_054280|Ga0466733_054280_2952_3611
- Length
- 219 aa
- Sequence
- MVYDGPIQDLIAELSRLPGIGPKGAQRIAFFLLDAEVADVKALADAIVRAKQTVKFCQICFNATEDDICRICRDPRRDHAQICVVEESKDIIAIERTREFKGLYHVLGGAISPIDNRGPADLHIRELVLRLEDGTVTEIILATNPNTEGEATASYLSRLLSPLGVEISRLASGLPVGGDLEYADDITLGRAFEGRRVLNAPTATPSLDGAALASTGATP
Sample Types
Isolate
35.0%
Metagenome
65.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.1%
Termitidae
19.7%
Apidae
7.6%
Kalotermitidae
7.6%
Anthocoridae
6.4%
Scarabaeidae
5.1%
Culicidae
4.5%
Tenebrionidae
3.8%
Elmidae
2.5%
Rhinotermitidae
1.9%
Armadillidiidae
1.9%
Cambaridae
1.9%
Formicidae
1.9%
Termopsidae
1.3%
Dytiscidae
1.3%
Passalidae
1.3%
Stratiomyidae
0.6%
Siricidae
0.6%
Chironomidae
0.6%
Cimicidae
0.6%
Cerambycidae
0.6%
Hydrophilidae
0.6%
Thomisidae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
1
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 2 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 3 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 4 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 5 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 6 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 7 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 8 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 9 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 10 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 11 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 15 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 16 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 17 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 18 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 19 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 20 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 21 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 22 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 23 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 24 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 25 | 2898589227 | Actinomadura macrotermitis RB68 | Isolate | Termitidae |
| 26 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 29 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 30 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 31 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 32 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 33 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 40 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 43 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 44 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 45 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 46 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 51 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 52 | 8073544309 | Actinomadura sp. RB99 | Isolate | Termitidae |
| 53 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 54 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 55 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 56 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 57 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 60 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 61 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 62 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 63 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 64 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 65 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 66 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 67 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 68 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 69 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 70 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 71 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 72 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 73 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 74 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 75 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 76 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 77 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 78 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 79 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 80 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 81 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 82 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 83 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 84 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 85 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 86 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 87 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 88 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 89 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 90 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 91 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 92 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 93 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 96 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 97 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 98 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 99 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 100 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 101 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 102 | 2856652821 | Actinomadura rubteroloni RB29 | Isolate | Unclassified |
| 103 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 104 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 105 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 106 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 107 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 108 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 109 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 110 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 111 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 112 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 113 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 114 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 115 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 116 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 117 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 118 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 119 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 120 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 121 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 122 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 123 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 124 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 125 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 126 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 127 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 128 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 129 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 130 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 131 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 132 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 133 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 134 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 135 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 136 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 137 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 138 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 139 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 140 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 141 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 142 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 143 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 144 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 145 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 146 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 147 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 148 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 149 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 150 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 151 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 152 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 153 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 154 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 155 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 156 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 157 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 158 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 159 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 160 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 161 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 162 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 163 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 164 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 165 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 166 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 167 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_176317 | 3300042659 | Bacteria | 141134 |
| 2 | Ga0562379_0288 | 3300056790 | Bacteria | 128595 |
| 3 | Ga0562375_2150 | 3300056856 | Bacteria | 23196 |
| 4 | Ga0466705_493220 | 3300042612 | Bacteria | 4031 |
| 5 | Ga0466711_221876 | 3300042615 | Bacteria | 3578 |
| 6 | Ga0466715_197587 | 3300042616 | Bacteria | 3920 |
| 7 | Ga0466715_231890 | 3300042616 | Bacteria | 35645 |
| 8 | Ga0466713_099446 | 3300042602 | Bacteria | 12797 |
| 9 | Ga0466714_019258 | 3300042603 | Bacteria | 1905 |
| 10 | Ga0466722_157850 | 3300042609 | Bacteria | 1407 |
| 11 | Ga0160452_100003 | 3300012834 | Bacteria | 748778 |
| 12 | Ga0160436_1000712 | 3300012861 | Bacteria | 11248 |
| 13 | Ga0264413_142802 | 3300024493 | Bacteria | 2071 |
| 14 | Ga0123355_11192373 | 3300009826 | Bacteria | 778 |
| 15 | Ga0123356_10185555 | 3300010049 | Bacteria | 2106 |
| 16 | Ga0123353_10158014 | 3300010167 | Bacteria | 3612 |
| 17 | Ga0123354_10000264 | 3300010882 | Bacteria | 47234 |
| 18 | Ga0123354_10176561 | 3300010882 | Unclassified | 2459 |
| 19 | Ga0123354_10208963 | 3300010882 | Bacteria | 2117 |
| 20 | 2227546030 | 2225789004 | Bacteria | 2918 |
| 21 | JGI24699J35502_11134097 | 3300002509 | Bacteria | 30240 |
| 22 | Ga0072941_1099290 | 3300005201 | Bacteria | 10260 |
| 23 | Ga0072941_1564743 | 3300005201 | Bacteria | 1615 |
| 24 | Ga0123357_10001031 | 3300009784 | Bacteria | 28573 |
| 25 | Ga0466730_011132 | 3300042625 | Bacteria | 16585 |
| 26 | Ga0466730_016618 | 3300042625 | Bacteria | 1429 |
| 27 | Ga0466708_343721 | 3300042652 | Bacteria | 1911 |
| 28 | Ga0530661_000086 | 3300056564 | Bacteria | 87401 |
| 29 | Ga0562377_1273 | 3300056842 | Unclassified | 27916 |
| 30 | Ga0562376_3815 | 3300056857 | Bacteria | 14273 |
| 31 | Ga0466712_319172 | 3300042614 | Archaea | 1165 |
| 32 | Ga0466723_294765 | 3300042618 | Bacteria | 13548 |
| 33 | Ga0466713_008347 | 3300042602 | Bacteria | 126123 |
| 34 | Ga0160440_104226 | 3300012815 | Unclassified | 1365 |
| 35 | Ga0160430_101330 | 3300012852 | Bacteria | 9473 |
| 36 | Ga0160448_130832 | 3300012854 | Bacteria | 778 |
| 37 | Ga0160457_1008491 | 3300012858 | Unclassified | 1479 |
| 38 | Ga0466657_147054 | 3300042582 | Bacteria | 1726 |
| 39 | Ga0123353_10380910 | 3300010167 | Bacteria | 2110 |
| 40 | JGI24699J35502_11132731 | 3300002509 | Bacteria | 7495 |
| 41 | Ga0466730_098120 | 3300042625 | Bacteria | 1446 |
| 42 | Ga0466725_126666 | 3300042654 | Unclassified | 2206 |
| 43 | Ga0466710_264543 | 3300042613 | Bacteria | 2808 |
| 44 | Ga0466711_212599 | 3300042615 | Unclassified | 3528 |
| 45 | Ga0466711_364129 | 3300042615 | Bacteria | 4185 |
| 46 | Ga0466723_167969 | 3300042618 | Bacteria | 59160 |
| 47 | Ga0466723_352448 | 3300042618 | Bacteria | 9857 |
| 48 | Ga0466707_253655 | 3300042601 | Bacteria | 8450 |
| 49 | Ga0466713_046305 | 3300042602 | Bacteria | 2140 |
| 50 | Ga0466713_137560 | 3300042602 | Bacteria | 64710 |
| 51 | Ga0466717_233423 | 3300042604 | Bacteria | 4627 |
| 52 | Ga0466719_362579 | 3300042606 | Bacteria | 29160 |
| 53 | Ga0160431_100918 | 3300012828 | Unclassified | 9395 |
| 54 | Ga0466657_388091 | 3300042582 | Bacteria | 1710 |
| 55 | Ga0466696_443284 | 3300042596 | Bacteria | 1941 |
| 56 | Ga0123357_10083143 | 3300009784 | Bacteria | 4202 |
| 57 | Ga0123357_10131948 | 3300009784 | Bacteria | 3106 |
| 58 | Ga0123357_10135533 | 3300009784 | Bacteria | 3047 |
| 59 | Ga0123356_11309743 | 3300010049 | Unclassified | 887 |
| 60 | Ga0123353_10447341 | 3300010167 | Bacteria | 1903 |
| 61 | Ga0123354_10454380 | 3300010882 | Bacteria | 1035 |
| 62 | Ga0160464_101258 | 3300012805 | Bacteria | 9928 |
| 63 | JGI24697J35500_11274203 | 3300002507 | Bacteria | 6731 |
| 64 | Ga0123357_10002911 | 3300009784 | Bacteria | 19316 |
| 65 | Ga0466729_267774 | 3300042621 | Bacteria | 1740 |
| 66 | Ga0466703_390040 | 3300042636 | Bacteria | 11700 |
| 67 | Ga0466733_054280 | 3300042659 | Bacteria | 11634 |
| 68 | Ga0562378_4135 | 3300056814 | Unclassified | 6376 |
| 69 | Ga0562375_0215 | 3300056856 | Unclassified | 160264 |
| 70 | Ga0562375_1695 | 3300056856 | Bacteria | 28151 |
| 71 | Ga0466705_480700 | 3300042612 | Bacteria | 3219 |
| 72 | Ga0466705_491639 | 3300042612 | Bacteria | 1607 |
| 73 | Ga0466718_019237 | 3300042617 | Bacteria | 2179 |
| 74 | Ga0466723_318753 | 3300042618 | Bacteria | 3611 |
| 75 | Ga0466701_039436 | 3300042598 | Bacteria | 2309 |
| 76 | Ga0466706_061522 | 3300042599 | Bacteria | 89301 |
| 77 | Ga0466706_157849 | 3300042599 | Bacteria | 1192 |
| 78 | Ga0466707_084824 | 3300042601 | Bacteria | 11382 |
| 79 | Ga0466707_352466 | 3300042601 | Unclassified | 22110 |
| 80 | Ga0466713_106670 | 3300042602 | Bacteria | 7555 |
| 81 | Ga0160469_108107 | 3300012824 | Bacteria | 974 |
| 82 | Ga0160434_105361 | 3300012850 | Unclassified | 2126 |
| 83 | Ga0466691_016906 | 3300042593 | Bacteria | 3751 |
| 84 | Ga0123356_11786317 | 3300010049 | Bacteria | 764 |
| 85 | Ga0123353_10000006 | 3300010167 | Bacteria | 279423 |
| 86 | Ga0123353_10397176 | 3300010167 | Bacteria | 2054 |
| 87 | Ga0123353_10420127 | 3300010167 | Bacteria | 1982 |
| 88 | Ga0123353_10458966 | 3300010167 | Bacteria | 1873 |
| 89 | Ga0123353_11094636 | 3300010167 | Bacteria | 1059 |
| 90 | Ga0123354_10285603 | 3300010882 | Bacteria | 1592 |
| 91 | Ga0123354_10400579 | 3300010882 | Bacteria | 1162 |
| 92 | Ga0466703_310091 | 3300042636 | Bacteria | 21772 |
| 93 | Ga0466704_451521 | 3300042643 | Bacteria | 2421 |
| 94 | Ga0466705_021968 | 3300042612 | Bacteria | 1157 |
| 95 | Ga0562376_2636 | 3300056857 | Bacteria | 20764 |
| 96 | Ga0466715_364312 | 3300042616 | Bacteria | 1084 |
| 97 | Ga0466726_386853 | 3300042619 | Bacteria | 1213 |
| 98 | Ga0466700_234943 | 3300042600 | Bacteria | 10370 |
| 99 | Ga0466722_080885 | 3300042609 | Bacteria | 53116 |
| 100 | Ga0466722_225517 | 3300042609 | Bacteria | 2932 |
| 101 | Ga0466698_060228 | 3300042610 | Bacteria | 1573 |
| 102 | Ga0160456_115023 | 3300012820 | Bacteria | 746 |
| 103 | Ga0160446_104471 | 3300012835 | Unclassified | 2076 |
| 104 | Ga0160457_1005458 | 3300012858 | Unclassified | 1938 |
| 105 | Ga0466696_386489 | 3300042596 | Bacteria | 2952 |
| 106 | Ga0123355_10927553 | 3300009826 | Bacteria | 940 |
| 107 | Ga0123353_10019105 | 3300010167 | Bacteria | 10167 |
| 108 | Ga0123353_10262660 | 3300010167 | Bacteria | 2665 |
| 109 | JGI24699J35502_11112100 | 3300002509 | Bacteria | 2746 |
| 110 | JGI24699J35502_11122120 | 3300002509 | Bacteria | 3403 |
| 111 | Ga0072941_1114836 | 3300005201 | Unclassified | 1828 |
| 112 | Ga0466734_145307 | 3300042623 | Bacteria | 1588 |
| 113 | Ga0466730_021593 | 3300042625 | Bacteria | 2946 |
| 114 | Ga0466704_073364 | 3300042643 | Bacteria | 257471 |
| 115 | Ga0466704_151212 | 3300042643 | Bacteria | 3309 |
| 116 | Ga0466704_417905 | 3300042643 | Bacteria | 3532 |
| 117 | Ga0466704_483633 | 3300042643 | Bacteria | 6633 |
| 118 | Ga0466727_181776 | 3300042655 | Bacteria | 23987 |
| 119 | Ga0466705_027162 | 3300042612 | Bacteria | 7767 |
| 120 | Ga0466733_042532 | 3300042659 | Bacteria | 28799 |
| 121 | Ga0562378_0478 | 3300056814 | Bacteria | 67323 |
| 122 | Ga0562377_3056 | 3300056842 | Unclassified | 9932 |
| 123 | Ga0466711_007779 | 3300042615 | Bacteria | 22172 |
| 124 | Ga0466713_098330 | 3300042602 | Bacteria | 2736 |
| 125 | Ga0466716_541513 | 3300042605 | Bacteria | 2758 |
| 126 | Ga0466693_270909 | 3300042592 | Bacteria | 2511 |
| 127 | Ga0466696_057259 | 3300042596 | Bacteria | 1357 |
| 128 | Ga0466696_357997 | 3300042596 | Bacteria | 1869 |
| 129 | Ga0123355_10251489 | 3300009826 | Bacteria | 2487 |
| 130 | Ga0123356_10821902 | 3300010049 | Bacteria | 1100 |
| 131 | Ga0123353_10950488 | 3300010167 | Bacteria | 1162 |
| 132 | Ga0123354_10000563 | 3300010882 | Bacteria | 38245 |
| 133 | JGI24702J35022_10000412 | 3300002462 | Bacteria | 25593 |
| 134 | JGI24705J35276_12199079 | 3300002504 | Bacteria | 1579 |
| 135 | Ga0466704_508228 | 3300042643 | Bacteria | 66197 |
| 136 | Ga0466727_203488 | 3300042655 | Bacteria | 1227 |
| 137 | Ga0466705_005862 | 3300042612 | Unclassified | 7964 |
| 138 | Ga0466723_367892 | 3300042618 | Bacteria | 6757 |
| 139 | Ga0466706_232817 | 3300042599 | Bacteria | 3072 |
| 140 | Ga0466707_290060 | 3300042601 | Bacteria | 3067 |
| 141 | Ga0466707_301351 | 3300042601 | Bacteria | 1366 |
| 142 | Ga0466714_091053 | 3300042603 | Bacteria | 33736 |
| 143 | Ga0160432_100170 | 3300012818 | Bacteria | 59840 |
| 144 | Ga0160430_100027 | 3300012852 | Bacteria | 204805 |
| 145 | Ga0160430_100107 | 3300012852 | Bacteria | 72484 |
| 146 | Ga0160430_100999 | 3300012852 | Bacteria | 12043 |
| 147 | Ga0466657_044751 | 3300042582 | Bacteria | 1376 |
| 148 | Ga0466657_216528 | 3300042582 | Bacteria | 22067 |
| 149 | Ga0466693_177220 | 3300042592 | Bacteria | 1478 |
| 150 | Ga0466693_320853 | 3300042592 | Bacteria | 7105 |
| 151 | Ga0466696_114571 | 3300042596 | Bacteria | 3471 |
| 152 | Ga0123356_10008941 | 3300010049 | Bacteria | 9916 |
| 153 | Ga0123356_10084121 | 3300010049 | Bacteria | 3015 |
| 154 | Ga0123354_10032039 | 3300010882 | Bacteria | 8243 |
| 155 | Ga0123354_10032163 | 3300010882 | Unclassified | 8225 |
| 156 | Ga0123354_10323729 | 3300010882 | Bacteria | 1418 |
| 157 | Ga0160442_102621 | 3300012806 | Bacteria | 1950 |
| 158 | IMNBL1DRAFT_c0127315 | 3300000062 | Unclassified | 665 |
| 159 | JGI24705J35276_12238733 | 3300002504 | Bacteria | 47947 |
| 160 | JGI24699J35502_11039096 | 3300002509 | Bacteria | 1562 |
| 161 | Ga0123357_10000064 | 3300009784 | Bacteria | 85199 |
| 162 | Ga0466730_026005 | 3300042625 | Unclassified | 66948 |
| 163 | Ga0466703_140736 | 3300042636 | Bacteria | 1982 |
| 164 | Ga0466703_200137 | 3300042636 | Bacteria | 99141 |
| 165 | Ga0466703_271211 | 3300042636 | Bacteria | 2208 |
| 166 | Ga0466705_351490 | 3300042612 | Bacteria | 2735 |
| 167 | Ga0466705_391293 | 3300042612 | Bacteria | 1785 |
| 168 | Ga0466713_121738 | 3300042602 | Bacteria | 1452 |
| 169 | Ga0160469_100404 | 3300012824 | Bacteria | 22467 |
| 170 | Ga0160469_105707 | 3300012824 | Bacteria | 1286 |
| 171 | Ga0160460_114051 | 3300012845 | Bacteria | 928 |
| 172 | Ga0160435_1000767 | 3300012857 | Bacteria | 9071 |
| 173 | Ga0466692_071366 | 3300042591 | Bacteria | 4505 |
| 174 | Ga0466694_266518 | 3300042594 | Bacteria | 2785 |
| 175 | Ga0123354_10023730 | 3300010882 | Bacteria | 9670 |
| 176 | JGI24705J35276_12226572 | 3300002504 | Bacteria | 2875 |
| 177 | Ga0466730_068437 | 3300042625 | Unclassified | 2216 |
| 178 | Ga0466730_096986 | 3300042625 | Bacteria | 1437 |
| 179 | Ga0466724_33525 | 3300042649 | Bacteria | 14940 |
| 180 | Ga0466725_169626 | 3300042654 | Bacteria | 7026 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.