Protein Family IF10262
Metagenome
Isolate
184
Members
71
Samples
162
Scaffolds
151.86
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_333780|Ga0466732_333780_96_650
- Length
- 184 aa
- Sequence
- LDFGKIQISDTSDLFLQRTGIDDFAIYQYNKMNTTGREDKNANNLFFLCSLIEYIGRKTKNHRNVVVNAIGKDNLQHIFDLADVYHSENMDKLAFELTEKHHIGYGIFDNVANAKYSIPTHWDIGKVYKRLIIDINEKEQKPFIDTLSEVYNSWLSRKIEDFNSSVYYESPKYLLQSYLTGENL
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.1%
Blattidae
18.6%
Unclassified
12.9%
Kalotermitidae
11.4%
Rhinotermitidae
4.3%
Passalidae
2.9%
Termopsidae
2.9%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
2
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 7 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 8 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 9 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 29 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 30 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 34 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 35 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 36 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 37 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 38 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 39 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 45 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 46 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 47 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 59 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 60 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 61 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 66 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 67 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 71 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_037673 | 3300042613 | Bacteria | 1786 |
| 2 | Ga0466710_261523 | 3300042613 | Bacteria | 3740 |
| 3 | Ga0466694_360185 | 3300042594 | Bacteria | 3249 |
| 4 | Ga0123357_10670180 | 3300009784 | Bacteria | 758 |
| 5 | Ga0123353_10416229 | 3300010167 | Bacteria | 1993 |
| 6 | Ga0123353_10463388 | 3300010167 | Bacteria | 1861 |
| 7 | Ga0123353_10950254 | 3300010167 | Bacteria | 1163 |
| 8 | Ga0466703_003045 | 3300042636 | Bacteria | 1440 |
| 9 | Ga0466703_023239 | 3300042636 | Bacteria | 13241 |
| 10 | Ga0466703_217072 | 3300042636 | Bacteria | 1734 |
| 11 | Ga0466704_165499 | 3300042643 | Bacteria | 1090 |
| 12 | Ga0466709_021408 | 3300042648 | Bacteria | 43480 |
| 13 | Ga0466725_155992 | 3300042654 | Bacteria | 1045 |
| 14 | JGI24705J35276_12198162 | 3300002504 | Bacteria | 1565 |
| 15 | JGI24696J40584_12898837 | 3300002834 | Bacteria | 1173 |
| 16 | Ga0072941_1300188 | 3300005201 | Bacteria | 790 |
| 17 | Ga0466700_364195 | 3300042600 | Bacteria | 1072 |
| 18 | Ga0466707_058180 | 3300042601 | Bacteria | 1107 |
| 19 | Ga0466719_123681 | 3300042606 | Bacteria | 4288 |
| 20 | Ga0466697_133148 | 3300042611 | Bacteria | 2133 |
| 21 | Ga0466697_144508 | 3300042611 | Bacteria | 1190 |
| 22 | Ga0466710_123645 | 3300042613 | Bacteria | 1528 |
| 23 | Ga0466710_124563 | 3300042613 | Bacteria | 1414 |
| 24 | Ga0466711_150539 | 3300042615 | Bacteria | 27789 |
| 25 | Ga0466728_472350 | 3300042620 | Bacteria | 3624 |
| 26 | Ga0466729_040253 | 3300042621 | Bacteria | 3339 |
| 27 | Ga0415639_126976 | 3300038395 | Bacteria | 2132 |
| 28 | Ga0466694_391835 | 3300042594 | Bacteria | 2131 |
| 29 | Ga0123356_13445799 | 3300010049 | Bacteria | 549 |
| 30 | Ga0123353_10500880 | 3300010167 | Bacteria | 1770 |
| 31 | Ga0123353_10501908 | 3300010167 | Bacteria | 1767 |
| 32 | Ga0123353_11455915 | 3300010167 | Bacteria | 876 |
| 33 | Ga0466729_309160 | 3300042621 | Bacteria | 5196 |
| 34 | Ga0466709_005483 | 3300042648 | Bacteria | 1813 |
| 35 | 2227555166 | 2225789004 | Bacteria | 14887 |
| 36 | IMNBL1DRAFT_c0000869 | 3300000062 | Bacteria | 23575 |
| 37 | IMNBL1DRAFT_c0039895 | 3300000062 | Bacteria | 1595 |
| 38 | IMNBL1DRAFT_c0049811 | 3300000062 | Bacteria | 1333 |
| 39 | JGI24702J35022_10039234 | 3300002462 | Unclassified | 2527 |
| 40 | JGI24702J35022_10218163 | 3300002462 | Bacteria | 1098 |
| 41 | JGI24696J40584_12691706 | 3300002834 | Bacteria | 729 |
| 42 | JGI24696J40584_12957610 | 3300002834 | Bacteria | 3603 |
| 43 | Ga0466698_492060 | 3300042610 | Bacteria | 2796 |
| 44 | Ga0466697_117664 | 3300042611 | Bacteria | 1172 |
| 45 | Ga0466733_133581 | 3300042659 | Bacteria | 1322 |
| 46 | Ga0466715_581715 | 3300042616 | Bacteria | 1258 |
| 47 | Ga0466718_004143 | 3300042617 | Bacteria | 1009 |
| 48 | Ga0466693_150339 | 3300042592 | Bacteria | 1196 |
| 49 | Ga0466695_136580 | 3300042595 | Bacteria | 1111 |
| 50 | Ga0123357_10139367 | 3300009784 | Bacteria | 2987 |
| 51 | Ga0123355_10004412 | 3300009826 | Bacteria | 20452 |
| 52 | Ga0123353_10811816 | 3300010167 | Bacteria | 1289 |
| 53 | Ga0123353_11602288 | 3300010167 | Bacteria | 822 |
| 54 | Ga0466735_029321 | 3300042624 | Bacteria | 1049 |
| 55 | Ga0466704_550075 | 3300042643 | Bacteria | 1670 |
| 56 | Ga0466725_063425 | 3300042654 | Bacteria | 5270 |
| 57 | 2227358575 | 2225789004 | Bacteria | 27923 |
| 58 | 2227519011 | 2225789004 | Bacteria | 671 |
| 59 | IMNBL1DRAFT_c0035802 | 3300000062 | Unclassified | 1744 |
| 60 | JGI24699J35502_10706078 | 3300002509 | Bacteria | 772 |
| 61 | Ga0466701_036714 | 3300042598 | Bacteria | 13564 |
| 62 | Ga0466707_413124 | 3300042601 | Bacteria | 7353 |
| 63 | Ga0466697_023709 | 3300042611 | Bacteria | 4165 |
| 64 | Ga0466697_203555 | 3300042611 | Bacteria | 1072 |
| 65 | Ga0466732_061552 | 3300042656 | Bacteria | 3914 |
| 66 | Ga0466733_186141 | 3300042659 | Bacteria | 8487 |
| 67 | Ga0466656_151871 | 3300042550 | Bacteria | 2123 |
| 68 | Ga0466693_409216 | 3300042592 | Bacteria | 1224 |
| 69 | Ga0123357_10052889 | 3300009784 | Bacteria | 5483 |
| 70 | Ga0123353_11423693 | 3300010167 | Bacteria | 889 |
| 71 | Ga0123353_11505544 | 3300010167 | Bacteria | 857 |
| 72 | Ga0466703_407474 | 3300042636 | Bacteria | 8743 |
| 73 | Ga0466727_306044 | 3300042655 | Bacteria | 7538 |
| 74 | IMNBL1DRAFT_c0033814 | 3300000062 | Bacteria | 1827 |
| 75 | JGI24695J34938_10071004 | 3300002450 | Bacteria | 1456 |
| 76 | JGI24702J35022_10128213 | 3300002462 | Bacteria | 1406 |
| 77 | Ga0072940_1272513 | 3300005200 | Unclassified | 1422 |
| 78 | Ga0466697_006901 | 3300042611 | Bacteria | 2187 |
| 79 | Ga0466697_051088 | 3300042611 | Bacteria | 4975 |
| 80 | Ga0466697_113021 | 3300042611 | Bacteria | 3978 |
| 81 | Ga0466733_102454 | 3300042659 | Bacteria | 1480 |
| 82 | Ga0466710_129465 | 3300042613 | Bacteria | 2356 |
| 83 | Ga0466656_202775 | 3300042550 | Bacteria | 1388 |
| 84 | Ga0123356_11437612 | 3300010049 | Bacteria | 849 |
| 85 | Ga0123353_10098255 | 3300010167 | Bacteria | 4718 |
| 86 | Ga0123353_11162855 | 3300010167 | Bacteria | 1017 |
| 87 | Ga0123354_10475737 | 3300010882 | Unclassified | 992 |
| 88 | Ga0466735_054357 | 3300042624 | Bacteria | 8325 |
| 89 | Ga0466702_064031 | 3300042635 | Bacteria | 1549 |
| 90 | Ga0466703_094530 | 3300042636 | Bacteria | 3562 |
| 91 | Ga0466725_043013 | 3300042654 | Bacteria | 25187 |
| 92 | Ga0466725_255323 | 3300042654 | Bacteria | 2103 |
| 93 | IMNBL1DRAFT_c0004065 | 3300000062 | Bacteria | 8976 |
| 94 | JGI24702J35022_10005414 | 3300002462 | Bacteria | 7470 |
| 95 | JGI24696J40584_12889912 | 3300002834 | Bacteria | 1125 |
| 96 | Ga0123357_10002151 | 3300009784 | Bacteria | 21723 |
| 97 | Ga0466707_167844 | 3300042601 | Bacteria | 1522 |
| 98 | Ga0466707_211891 | 3300042601 | Bacteria | 4541 |
| 99 | Ga0466720_211850 | 3300042607 | Bacteria | 6902 |
| 100 | Ga0466657_241454 | 3300042582 | Bacteria | 1558 |
| 101 | Ga0466690_372082 | 3300042590 | Bacteria | 3762 |
| 102 | Ga0466693_085249 | 3300042592 | Bacteria | 1255 |
| 103 | Ga0123356_10044490 | 3300010049 | Bacteria | 4132 |
| 104 | Ga0123354_10352839 | 3300010882 | Bacteria | 1309 |
| 105 | Ga0123354_10416634 | 3300010882 | Unclassified | 1121 |
| 106 | Ga0466735_189447 | 3300042624 | Bacteria | 1100 |
| 107 | Ga0466703_049076 | 3300042636 | Bacteria | 2961 |
| 108 | Ga0466709_059097 | 3300042648 | Bacteria | 13875 |
| 109 | 2227591272 | 2225789004 | Bacteria | 49846 |
| 110 | JGI24695J34938_10195706 | 3300002450 | Unclassified | 841 |
| 111 | JGI24696J40584_12912788 | 3300002834 | Bacteria | 1270 |
| 112 | Ga0466701_032734 | 3300042598 | Bacteria | 1416 |
| 113 | Ga0466707_185312 | 3300042601 | Bacteria | 99373 |
| 114 | Ga0466717_018688 | 3300042604 | Viruses | 1256 |
| 115 | Ga0466722_199751 | 3300042609 | Bacteria | 4536 |
| 116 | Ga0466697_261516 | 3300042611 | Bacteria | 1952 |
| 117 | Ga0466732_333780 | 3300042656 | Bacteria | 1256 |
| 118 | Ga0466710_102018 | 3300042613 | Bacteria | 1989 |
| 119 | Ga0466710_345172 | 3300042613 | Bacteria | 1000 |
| 120 | Ga0466656_216715 | 3300042550 | Bacteria | 1228 |
| 121 | Ga0123357_10214435 | 3300009784 | Bacteria | 2153 |
| 122 | Ga0123355_10001670 | 3300009826 | Bacteria | 30904 |
| 123 | Ga0123356_12855832 | 3300010049 | Bacteria | 604 |
| 124 | Ga0123354_10019376 | 3300010882 | Bacteria | 10686 |
| 125 | Ga0123354_10235582 | 3300010882 | Unclassified | 1900 |
| 126 | Ga0466704_086130 | 3300042643 | Bacteria | 4079 |
| 127 | Ga0466704_277748 | 3300042643 | Bacteria | 2455 |
| 128 | IMNBL1DRAFT_c0079307 | 3300000062 | Bacteria | 924 |
| 129 | JGI24705J35276_12193226 | 3300002504 | Bacteria | 1496 |
| 130 | JGI24699J35502_11083997 | 3300002509 | Bacteria | 2019 |
| 131 | JGI24699J35502_11133561 | 3300002509 | Bacteria | 11948 |
| 132 | Ga0466714_003578 | 3300042603 | Bacteria | 44727 |
| 133 | Ga0466717_241111 | 3300042604 | Bacteria | 1293 |
| 134 | Ga0466722_188136 | 3300042609 | Bacteria | 1127 |
| 135 | Ga0466697_035298 | 3300042611 | Bacteria | 1018 |
| 136 | Ga0466710_413095 | 3300042613 | Bacteria | 1920 |
| 137 | Ga0466728_070781 | 3300042620 | Bacteria | 23698 |
| 138 | Ga0466656_260405 | 3300042550 | Bacteria | 1214 |
| 139 | Ga0466693_023603 | 3300042592 | Unclassified | 1745 |
| 140 | Ga0466699_346967 | 3300042597 | Bacteria | 2074 |
| 141 | Ga0123356_10027824 | 3300010049 | Bacteria | 5297 |
| 142 | Ga0123356_10600402 | 3300010049 | Bacteria | 1265 |
| 143 | Ga0123353_10003062 | 3300010167 | Bacteria | 20931 |
| 144 | Ga0123354_10004397 | 3300010882 | Bacteria | 19955 |
| 145 | Ga0466734_109135 | 3300042623 | Bacteria | 2439 |
| 146 | Ga0466734_172413 | 3300042623 | Bacteria | 1638 |
| 147 | Ga0466735_115049 | 3300042624 | Bacteria | 1316 |
| 148 | Ga0466703_052543 | 3300042636 | Bacteria | 1533 |
| 149 | Ga0466725_115711 | 3300042654 | Bacteria | 23801 |
| 150 | 2227614070 | 2225789004 | Unclassified | 2239 |
| 151 | IMNBL1DRAFT_c0027042 | 3300000062 | Bacteria | 2166 |
| 152 | IMNBL1DRAFT_c0134013 | 3300000062 | Bacteria | 643 |
| 153 | JGI24698J34947_10227351 | 3300002449 | Bacteria | 711 |
| 154 | JGI24702J35022_10149151 | 3300002462 | Bacteria | 1311 |
| 155 | JGI24702J35022_10546478 | 3300002462 | Bacteria | 713 |
| 156 | JGI24705J35276_12201938 | 3300002504 | Viruses | 1627 |
| 157 | Ga0123357_10000761 | 3300009784 | Bacteria | 32497 |
| 158 | Ga0466700_418615 | 3300042600 | Bacteria | 2070 |
| 159 | Ga0466707_040661 | 3300042601 | Bacteria | 2106 |
| 160 | Ga0466707_342240 | 3300042601 | Bacteria | 2798 |
| 161 | Ga0466713_126218 | 3300042602 | Bacteria | 23294 |
| 162 | Ga0466722_171564 | 3300042609 | Bacteria | 8658 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.