Protein Family IF10220
Metagenome
Isolate
169
Members
41
Samples
157
Scaffolds
127.69
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_025340|Ga0466732_025340_1518_1916
- Length
- 132 aa
- Sequence
- VHESAENYLETILILSSRGKVRSIDIVNELEYSKPSVSVAMKNLRSKGCITTDGGCIALTDEGRKIAVSMYERHVAISDWLIFLGVDKKTAVQDACRMEHAMSEKSFSAIKKHIEKWKKETNKPDDTKPKKP
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.1%
Unclassified
30.8%
Kalotermitidae
2.6%
Passalidae
2.6%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 2 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 3 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 21 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 22 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 29 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 30 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 31 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 39 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_023718 | 3300042656 | Bacteria | 2564 |
| 2 | Ga0466712_066074 | 3300042614 | Bacteria | 6320 |
| 3 | Ga0466712_083777 | 3300042614 | Bacteria | 8878 |
| 4 | Ga0466712_085272 | 3300042614 | Bacteria | 7460 |
| 5 | Ga0466712_121129 | 3300042614 | Bacteria | 2631 |
| 6 | Ga0466712_237446 | 3300042614 | Bacteria | 2254 |
| 7 | Ga0466712_323876 | 3300042614 | Bacteria | 1467 |
| 8 | Ga0466718_030669 | 3300042617 | Bacteria | 1143 |
| 9 | Ga0415639_043715 | 3300038395 | Bacteria | 2873 |
| 10 | Ga0466694_028651 | 3300042594 | Unclassified | 1671 |
| 11 | Ga0466699_035590 | 3300042597 | Bacteria | 1799 |
| 12 | Ga0466699_090719 | 3300042597 | Bacteria | 11658 |
| 13 | Ga0466699_247004 | 3300042597 | Bacteria | 1355 |
| 14 | Ga0466699_443791 | 3300042597 | Bacteria | 1691 |
| 15 | JGI24698J34947_10024477 | 3300002449 | Bacteria | 3223 |
| 16 | JGI24698J34947_10044748 | 3300002449 | Bacteria | 2263 |
| 17 | JGI24698J34947_10065255 | 3300002449 | Bacteria | 1775 |
| 18 | JGI24698J34947_10087172 | 3300002449 | Unclassified | 1444 |
| 19 | JGI24695J34938_10000821 | 3300002450 | Bacteria | 28895 |
| 20 | JGI24695J34938_10014240 | 3300002450 | Bacteria | 4133 |
| 21 | JGI24695J34938_10122331 | 3300002450 | Bacteria | 1059 |
| 22 | JGI24695J34938_10161768 | 3300002450 | Bacteria | 920 |
| 23 | Ga0072941_1017551 | 3300005201 | Bacteria | 6972 |
| 24 | Ga0466714_021559 | 3300042603 | Bacteria | 2267 |
| 25 | Ga0466720_069356 | 3300042607 | Bacteria | 6117 |
| 26 | Ga0466702_272464 | 3300042635 | Bacteria | 1752 |
| 27 | Ga0466712_150871 | 3300042614 | Bacteria | 6880 |
| 28 | Ga0466715_029604 | 3300042616 | Bacteria | 97338 |
| 29 | Ga0466718_043993 | 3300042617 | Bacteria | 1528 |
| 30 | Ga0466656_197221 | 3300042550 | Bacteria | 1773 |
| 31 | Ga0466699_138509 | 3300042597 | Bacteria | 1649 |
| 32 | Ga0466699_325728 | 3300042597 | Bacteria | 11474 |
| 33 | Ga0466699_381813 | 3300042597 | Bacteria | 1219 |
| 34 | Ga0123353_10270143 | 3300010167 | Bacteria | 2620 |
| 35 | Ga0123353_10585711 | 3300010167 | Bacteria | 1599 |
| 36 | Ga0123354_11004533 | 3300010882 | Bacteria | 536 |
| 37 | AustNasuHG_c1014204 | 3300000089 | Bacteria | 2714 |
| 38 | JGI24698J34947_10002903 | 3300002449 | Bacteria | 9293 |
| 39 | JGI24698J34947_10086879 | 3300002449 | Unclassified | 1447 |
| 40 | JGI24698J34947_10156987 | 3300002449 | Unclassified | 937 |
| 41 | JGI24695J34938_10006167 | 3300002450 | Bacteria | 7290 |
| 42 | JGI24695J34938_10103481 | 3300002450 | Bacteria | 1162 |
| 43 | JGI24695J34938_10159377 | 3300002450 | Bacteria | 927 |
| 44 | JGI24702J35022_10111275 | 3300002462 | Bacteria | 1506 |
| 45 | JGI24705J35276_11655561 | 3300002504 | Bacteria | 613 |
| 46 | Ga0074263_119771 | 3300005485 | Unclassified | 840 |
| 47 | Ga0466720_135295 | 3300042607 | Bacteria | 9104 |
| 48 | Ga0466720_217711 | 3300042607 | Bacteria | 2189 |
| 49 | Ga0466732_090691 | 3300042656 | Bacteria | 1183 |
| 50 | Ga0466712_099190 | 3300042614 | Bacteria | 4778 |
| 51 | Ga0466712_142643 | 3300042614 | Bacteria | 11754 |
| 52 | Ga0466718_105215 | 3300042617 | Bacteria | 3635 |
| 53 | Ga0466699_034467 | 3300042597 | Unclassified | 2468 |
| 54 | JGI24698J34947_10008999 | 3300002449 | Bacteria | 5476 |
| 55 | JGI24698J34947_10026200 | 3300002449 | Bacteria | 3100 |
| 56 | JGI24698J34947_10066252 | 3300002449 | Unclassified | 1758 |
| 57 | JGI24695J34938_10001404 | 3300002450 | Bacteria | 20578 |
| 58 | JGI24695J34938_10084534 | 3300002450 | Bacteria | 1308 |
| 59 | Ga0466720_083301 | 3300042607 | Bacteria | 8629 |
| 60 | Ga0466702_449492 | 3300042635 | Bacteria | 10647 |
| 61 | Ga0466712_022092 | 3300042614 | Bacteria | 5123 |
| 62 | Ga0466712_055457 | 3300042614 | Bacteria | 16691 |
| 63 | Ga0466712_090232 | 3300042614 | Bacteria | 2131 |
| 64 | Ga0466712_237664 | 3300042614 | Bacteria | 1289 |
| 65 | Ga0466712_254852 | 3300042614 | Bacteria | 1122 |
| 66 | Ga0466712_261754 | 3300042614 | Bacteria | 4997 |
| 67 | Ga0415639_087480 | 3300038395 | Bacteria | 1587 |
| 68 | Ga0466694_142503 | 3300042594 | Bacteria | 10299 |
| 69 | Ga0466694_223281 | 3300042594 | Bacteria | 2707 |
| 70 | Ga0466699_167042 | 3300042597 | Bacteria | 4024 |
| 71 | Ga0466699_427813 | 3300042597 | Bacteria | 2935 |
| 72 | 2227080807 | 2225789004 | Bacteria | 40165 |
| 73 | JGI24698J34947_10004668 | 3300002449 | Bacteria | 7475 |
| 74 | JGI24705J35276_11633584 | 3300002504 | Bacteria | 604 |
| 75 | JGI24699J35502_11097337 | 3300002509 | Unclassified | 2268 |
| 76 | Ga0466720_062977 | 3300042607 | Bacteria | 6347 |
| 77 | Ga0466720_187419 | 3300042607 | Bacteria | 11208 |
| 78 | Ga0466712_035861 | 3300042614 | Bacteria | 4986 |
| 79 | Ga0466712_053039 | 3300042614 | Bacteria | 1209 |
| 80 | Ga0466712_278342 | 3300042614 | Bacteria | 2617 |
| 81 | Ga0466712_297775 | 3300042614 | Bacteria | 1374 |
| 82 | Ga0466712_314887 | 3300042614 | Bacteria | 10326 |
| 83 | Ga0466699_012538 | 3300042597 | Unclassified | 1743 |
| 84 | Ga0466699_058934 | 3300042597 | Bacteria | 1407 |
| 85 | Ga0466699_218119 | 3300042597 | Bacteria | 9194 |
| 86 | Ga0466699_238109 | 3300042597 | Bacteria | 1736 |
| 87 | Ga0466699_242531 | 3300042597 | Bacteria | 1137 |
| 88 | Ga0466699_328563 | 3300042597 | Bacteria | 1362 |
| 89 | Ga0466699_359606 | 3300042597 | Bacteria | 9816 |
| 90 | Ga0123355_10000488 | 3300009826 | Bacteria | 52648 |
| 91 | Ga0123353_11043338 | 3300010167 | Bacteria | 1093 |
| 92 | AustNasuHG_c1003095 | 3300000089 | Bacteria | 6007 |
| 93 | JGI24698J34947_10102273 | 3300002449 | Bacteria | 1285 |
| 94 | JGI24695J34938_10014832 | 3300002450 | Bacteria | 4019 |
| 95 | JGI24705J35276_11493117 | 3300002504 | Bacteria | 555 |
| 96 | JGI24705J35276_12139141 | 3300002504 | Bacteria | 1134 |
| 97 | Ga0466720_005202 | 3300042607 | Unclassified | 4305 |
| 98 | Ga0466720_020983 | 3300042607 | Bacteria | 11224 |
| 99 | Ga0466720_069212 | 3300042607 | Bacteria | 9347 |
| 100 | Ga0466720_098254 | 3300042607 | Unclassified | 1395 |
| 101 | Ga0466693_091587 | 3300042592 | Unclassified | 1035 |
| 102 | Ga0123357_10278316 | 3300009784 | Bacteria | 1734 |
| 103 | Ga0123353_10126089 | 3300010167 | Bacteria | 4114 |
| 104 | Ga0123354_10038518 | 3300010882 | Bacteria | 7420 |
| 105 | Ga0123354_11052576 | 3300010882 | Bacteria | 520 |
| 106 | AustNasuHG_c1007943 | 3300000089 | Bacteria | 3761 |
| 107 | JGI24698J34947_10002453 | 3300002449 | Bacteria | 9995 |
| 108 | JGI24698J34947_10058495 | 3300002449 | Bacteria | 1908 |
| 109 | JGI24698J34947_10247491 | 3300002449 | Bacteria | 668 |
| 110 | JGI24702J35022_10918002 | 3300002462 | Bacteria | 545 |
| 111 | Ga0072941_1006989 | 3300005201 | Bacteria | 5078 |
| 112 | Ga0072941_1024500 | 3300005201 | Bacteria | 1394 |
| 113 | Ga0466714_033518 | 3300042603 | Bacteria | 19938 |
| 114 | Ga0466720_021177 | 3300042607 | Unclassified | 7356 |
| 115 | Ga0466732_025340 | 3300042656 | Bacteria | 3804 |
| 116 | Ga0466712_134669 | 3300042614 | Bacteria | 13333 |
| 117 | Ga0466694_269583 | 3300042594 | Bacteria | 2807 |
| 118 | Ga0466699_050918 | 3300042597 | Bacteria | 1266 |
| 119 | Ga0466699_099509 | 3300042597 | Bacteria | 5436 |
| 120 | Ga0466699_216839 | 3300042597 | Bacteria | 1144 |
| 121 | Ga0123356_10138449 | 3300010049 | Bacteria | 2398 |
| 122 | Ga0123353_10083432 | 3300010167 | Bacteria | 5142 |
| 123 | Ga0123353_10443726 | 3300010167 | Bacteria | 1913 |
| 124 | Ga0123353_12378051 | 3300010167 | Unclassified | 634 |
| 125 | JGI24698J34947_10003508 | 3300002449 | Bacteria | 8519 |
| 126 | JGI24698J34947_10004965 | 3300002449 | Bacteria | 7288 |
| 127 | JGI24698J34947_10044758 | 3300002449 | Bacteria | 2263 |
| 128 | JGI24698J34947_10079921 | 3300002449 | Bacteria | 1538 |
| 129 | JGI24695J34938_10002162 | 3300002450 | Bacteria | 15341 |
| 130 | JGI24695J34938_10021649 | 3300002450 | Bacteria | 3139 |
| 131 | JGI24696J40584_12953977 | 3300002834 | Bacteria | 2564 |
| 132 | Ga0466720_059350 | 3300042607 | Bacteria | 27311 |
| 133 | Ga0466720_062545 | 3300042607 | Bacteria | 17805 |
| 134 | Ga0466720_064009 | 3300042607 | Unclassified | 1697 |
| 135 | Ga0466702_270546 | 3300042635 | Bacteria | 3123 |
| 136 | Ga0466712_008265 | 3300042614 | Bacteria | 1129 |
| 137 | Ga0466718_129342 | 3300042617 | Archaea | 5282 |
| 138 | Ga0264413_102061 | 3300024493 | Bacteria | 2277 |
| 139 | Ga0466699_122570 | 3300042597 | Unclassified | 2466 |
| 140 | Ga0466699_172754 | 3300042597 | Unclassified | 1712 |
| 141 | Ga0466699_194813 | 3300042597 | Unclassified | 1340 |
| 142 | Ga0466699_387770 | 3300042597 | Bacteria | 2078 |
| 143 | Ga0123357_10394068 | 3300009784 | Bacteria | 1268 |
| 144 | Ga0123356_10188763 | 3300010049 | Bacteria | 2089 |
| 145 | Ga0123353_10148173 | 3300010167 | Bacteria | 3750 |
| 146 | Ga0123353_12159032 | 3300010167 | Bacteria | 675 |
| 147 | AustNasuHG_c1015454 | 3300000089 | Bacteria | 2575 |
| 148 | JGI24698J34947_10240898 | 3300002449 | Bacteria | 681 |
| 149 | JGI24695J34938_10005470 | 3300002450 | Bacteria | 7913 |
| 150 | JGI24695J34938_10081767 | 3300002450 | Bacteria | 1334 |
| 151 | JGI24702J35022_10039716 | 3300002462 | Bacteria | 2510 |
| 152 | JGI24702J35022_10042064 | 3300002462 | Bacteria | 2435 |
| 153 | JGI24702J35022_10541201 | 3300002462 | Bacteria | 717 |
| 154 | JGI24705J35276_11600651 | 3300002504 | Bacteria | 591 |
| 155 | JGI24697J35500_11266947 | 3300002507 | Unclassified | 3583 |
| 156 | Ga0072941_1079929 | 3300005201 | Bacteria | 18238 |
| 157 | Ga0466720_019572 | 3300042607 | Bacteria | 7555 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01325 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.