Protein Family IF10218
Metagenome
Isolate
287
Members
66
Samples
273
Scaffolds
443.61
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_009350|Ga0466732_009350_299_1630
- Length
- 428 aa
- Sequence
- MFESVTKSQAAEKILESVREYYKTFMRNPPYRPGDRIPYAARVFDEREMVNLVDSALEFWLTAGRYTDMFEKQLSDYLRVPYCSLVNSGSSANLAAFTALTSPLLGDRAVVRGDEVITVAAGFPTTVAPILQFGAVPVFVDVAIPQYNIDVSLLERALSPKTKAVMLAHTLGNPFDLETVSGFCRANNLWLVEDNCDALGSTYGIGGEKKFTGTVGDIGTSSFYPPHHLTMGEGGAVYTSDPLLHKIIRSMRDWGRDCVCPSELPAGYDHKYVYSHFGYNLKATDMQAAIGCAQLEKFPSFVEKRKHNWRRLYDGLKDLSDKLILPEPAPGSDPSWFGFLITCREGVSRNELVKRIEAENIQTRMLFAGNLVKHPCFDALRKSGEGYRIAGTLDNTDRIMNDAFWVGVYPGMNDGMIDRMAEVIRKSC
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Unclassified
25.4%
Kalotermitidae
22.2%
Termopsidae
4.8%
Rhinotermitidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
2
Bacteria
276
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 2 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 5 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 6 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2773857690 | Unclassified Methanomassiliicoccaceae Nt197P4bin30 | Isolate | Unclassified |
| 21 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 28 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 39 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 53 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 54 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 55 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_223221 | 3300042612 | Bacteria | 2655 |
| 2 | Ga0415639_028839 | 3300038395 | Bacteria | 21248 |
| 3 | Ga0466691_170012 | 3300042593 | Bacteria | 38393 |
| 4 | Ga0466699_347672 | 3300042597 | Bacteria | 12357 |
| 5 | Ga0466712_088778 | 3300042614 | Unclassified | 2224 |
| 6 | Ga0466712_314281 | 3300042614 | Bacteria | 47963 |
| 7 | Ga0466715_208122 | 3300042616 | Bacteria | 3176 |
| 8 | Ga0466718_142481 | 3300042617 | Bacteria | 11116 |
| 9 | Ga0466726_403007 | 3300042619 | Bacteria | 1564 |
| 10 | Ga0123355_10000666 | 3300009826 | Bacteria | 46536 |
| 11 | Ga0123355_10006641 | 3300009826 | Bacteria | 17181 |
| 12 | Ga0123355_10056869 | 3300009826 | Bacteria | 6331 |
| 13 | Ga0466702_157475 | 3300042635 | Bacteria | 3790 |
| 14 | Ga0466703_082503 | 3300042636 | Bacteria | 12920 |
| 15 | Ga0466703_354542 | 3300042636 | Bacteria | 13164 |
| 16 | Ga0466703_404069 | 3300042636 | Bacteria | 6510 |
| 17 | Ga0466704_177421 | 3300042643 | Bacteria | 22593 |
| 18 | Ga0466704_269891 | 3300042643 | Bacteria | 69200 |
| 19 | Ga0466709_131545 | 3300042648 | Bacteria | 3803 |
| 20 | Ga0466709_374247 | 3300042648 | Bacteria | 9528 |
| 21 | Ga0466708_048088 | 3300042652 | Bacteria | 4122 |
| 22 | Ga0466708_143853 | 3300042652 | Bacteria | 12069 |
| 23 | Ga0466706_101167 | 3300042599 | Bacteria | 3060 |
| 24 | Ga0466706_110557 | 3300042599 | Bacteria | 17103 |
| 25 | Ga0466707_128337 | 3300042601 | Bacteria | 1496 |
| 26 | Ga0466716_140236 | 3300042605 | Bacteria | 10231 |
| 27 | Ga0466719_223104 | 3300042606 | Bacteria | 3533 |
| 28 | AustNasuHG_c1022633 | 3300000089 | Bacteria | 2017 |
| 29 | JGI24698J34947_10003584 | 3300002449 | Bacteria | 8435 |
| 30 | JGI24698J34947_10003620 | 3300002449 | Bacteria | 8396 |
| 31 | JGI24698J34947_10005495 | 3300002449 | Bacteria | 6954 |
| 32 | JGI24698J34947_10008065 | 3300002449 | Bacteria | 5780 |
| 33 | JGI24698J34947_10009443 | 3300002449 | Bacteria | 5354 |
| 34 | JGI24695J34938_10019919 | 3300002450 | Bacteria | 3312 |
| 35 | JGI24695J34938_10048892 | 3300002450 | Bacteria | 1861 |
| 36 | Ga0466705_115912 | 3300042612 | Bacteria | 13386 |
| 37 | Ga0466705_188536 | 3300042612 | Bacteria | 16471 |
| 38 | Ga0466732_009350 | 3300042656 | Bacteria | 2028 |
| 39 | Ga0264413_119832 | 3300024493 | Unclassified | 16919 |
| 40 | Ga0264413_130029 | 3300024493 | Bacteria | 11639 |
| 41 | Ga0466690_102704 | 3300042590 | Bacteria | 9550 |
| 42 | Ga0466690_157460 | 3300042590 | Bacteria | 3707 |
| 43 | Ga0466690_187049 | 3300042590 | Bacteria | 2390 |
| 44 | Ga0466691_079087 | 3300042593 | Bacteria | 5781 |
| 45 | Ga0466691_081550 | 3300042593 | Bacteria | 4811 |
| 46 | Ga0466691_109358 | 3300042593 | Bacteria | 16450 |
| 47 | Ga0466694_210483 | 3300042594 | Bacteria | 8464 |
| 48 | Ga0466696_184860 | 3300042596 | Bacteria | 1484 |
| 49 | Ga0466715_263798 | 3300042616 | Bacteria | 6465 |
| 50 | Ga0466715_462602 | 3300042616 | Bacteria | 6765 |
| 51 | Ga0466723_185666 | 3300042618 | Bacteria | 15931 |
| 52 | Ga0466723_203180 | 3300042618 | Bacteria | 3529 |
| 53 | Ga0123355_10000180 | 3300009826 | Bacteria | 77979 |
| 54 | Ga0123353_10003451 | 3300010167 | Bacteria | 19967 |
| 55 | Ga0123353_10122078 | 3300010167 | Bacteria | 4188 |
| 56 | Ga0123353_10179199 | 3300010167 | Bacteria | 3357 |
| 57 | Ga0123353_10299030 | 3300010167 | Bacteria | 2458 |
| 58 | Ga0466704_399508 | 3300042643 | Bacteria | 4952 |
| 59 | Ga0466708_436452 | 3300042652 | Bacteria | 2468 |
| 60 | Ga0466706_156050 | 3300042599 | Bacteria | 30296 |
| 61 | Ga0466706_248492 | 3300042599 | Bacteria | 2195 |
| 62 | Ga0466706_287910 | 3300042599 | Bacteria | 14097 |
| 63 | Ga0466707_029392 | 3300042601 | Bacteria | 33119 |
| 64 | Ga0466707_041776 | 3300042601 | Bacteria | 7642 |
| 65 | Ga0466707_052451 | 3300042601 | Bacteria | 10170 |
| 66 | Ga0466707_330591 | 3300042601 | Unclassified | 15201 |
| 67 | Ga0466720_150015 | 3300042607 | Bacteria | 24917 |
| 68 | Ga0466698_386815 | 3300042610 | Bacteria | 2118 |
| 69 | JGI24698J34947_10003356 | 3300002449 | Bacteria | 8692 |
| 70 | JGI24695J34938_10000444 | 3300002450 | Bacteria | 40024 |
| 71 | JGI24695J34938_10053570 | 3300002450 | Bacteria | 1754 |
| 72 | Ga0466705_339203 | 3300042612 | Bacteria | 8687 |
| 73 | Ga0466690_190051 | 3300042590 | Bacteria | 4807 |
| 74 | Ga0466692_033390 | 3300042591 | Bacteria | 41545 |
| 75 | Ga0466691_191891 | 3300042593 | Bacteria | 11029 |
| 76 | Ga0466691_218524 | 3300042593 | Bacteria | 23030 |
| 77 | Ga0466694_130510 | 3300042594 | Bacteria | 4809 |
| 78 | Ga0466699_042694 | 3300042597 | Bacteria | 13384 |
| 79 | Ga0466699_232418 | 3300042597 | Bacteria | 1927 |
| 80 | Ga0466699_300860 | 3300042597 | Bacteria | 3320 |
| 81 | Ga0466712_120902 | 3300042614 | Bacteria | 11264 |
| 82 | Ga0466711_021906 | 3300042615 | Bacteria | 3199 |
| 83 | Ga0466711_392626 | 3300042615 | Bacteria | 26142 |
| 84 | Ga0466715_230404 | 3300042616 | Bacteria | 2981 |
| 85 | Ga0466715_350976 | 3300042616 | Bacteria | 6860 |
| 86 | Ga0466715_355642 | 3300042616 | Bacteria | 6848 |
| 87 | Ga0466723_043077 | 3300042618 | Bacteria | 4515 |
| 88 | Ga0466726_159830 | 3300042619 | Bacteria | 6417 |
| 89 | Ga0466726_313700 | 3300042619 | Bacteria | 3711 |
| 90 | Ga0123355_10095529 | 3300009826 | Bacteria | 4697 |
| 91 | Ga0123356_10029521 | 3300010049 | Bacteria | 5135 |
| 92 | Ga0123356_10281735 | 3300010049 | Bacteria | 1758 |
| 93 | Ga0466703_046739 | 3300042636 | Bacteria | 28227 |
| 94 | Ga0466703_410918 | 3300042636 | Bacteria | 11366 |
| 95 | Ga0466703_431254 | 3300042636 | Unclassified | 4866 |
| 96 | Ga0466709_376555 | 3300042648 | Unclassified | 42840 |
| 97 | Ga0466707_373030 | 3300042601 | Bacteria | 1620 |
| 98 | Ga0466713_050320 | 3300042602 | Bacteria | 13530 |
| 99 | Ga0466716_293751 | 3300042605 | Bacteria | 3166 |
| 100 | Ga0466719_335701 | 3300042606 | Bacteria | 3772 |
| 101 | Ga0466719_408307 | 3300042606 | Bacteria | 1549 |
| 102 | Ga0466720_042936 | 3300042607 | Bacteria | 30548 |
| 103 | Ga0466698_387136 | 3300042610 | Bacteria | 6257 |
| 104 | AustNasuHG_c1003838 | 3300000089 | Bacteria | 5411 |
| 105 | AustNasuHG_c1025899 | 3300000089 | Bacteria | 1836 |
| 106 | JGI24705J35276_12236802 | 3300002504 | Bacteria | 8953 |
| 107 | Ga0072941_1055013 | 3300005201 | Bacteria | 8047 |
| 108 | Ga0466690_133899 | 3300042590 | Bacteria | 17989 |
| 109 | Ga0466692_024117 | 3300042591 | Bacteria | 20878 |
| 110 | Ga0466691_018555 | 3300042593 | Bacteria | 15185 |
| 111 | Ga0466694_148633 | 3300042594 | Bacteria | 2348 |
| 112 | Ga0466696_136032 | 3300042596 | Bacteria | 8535 |
| 113 | Ga0466699_064929 | 3300042597 | Bacteria | 24291 |
| 114 | Ga0466699_102165 | 3300042597 | Unclassified | 19151 |
| 115 | Ga0466712_066136 | 3300042614 | Bacteria | 21806 |
| 116 | Ga0466712_163716 | 3300042614 | Bacteria | 2089 |
| 117 | Ga0466711_227597 | 3300042615 | Archaea | 1882 |
| 118 | Ga0466711_317221 | 3300042615 | Bacteria | 1773 |
| 119 | Ga0466711_502009 | 3300042615 | Bacteria | 2138 |
| 120 | Ga0466718_065809 | 3300042617 | Bacteria | 5535 |
| 121 | Ga0466718_170195 | 3300042617 | Bacteria | 7290 |
| 122 | Ga0466726_175980 | 3300042619 | Bacteria | 1794 |
| 123 | Ga0466728_076493 | 3300042620 | Bacteria | 12965 |
| 124 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 125 | Ga0123356_10048174 | 3300010049 | Bacteria | 3966 |
| 126 | Ga0123353_10008185 | 3300010167 | Bacteria | 14243 |
| 127 | Ga0123353_10222523 | 3300010167 | Bacteria | 2950 |
| 128 | Ga0123353_10292817 | 3300010167 | Bacteria | 2491 |
| 129 | Ga0123353_10425281 | 3300010167 | Bacteria | 1966 |
| 130 | Ga0466731_048131 | 3300042622 | Bacteria | 17747 |
| 131 | Ga0466730_039792 | 3300042625 | Bacteria | 2101 |
| 132 | Ga0466703_087464 | 3300042636 | Bacteria | 2721 |
| 133 | Ga0466703_414085 | 3300042636 | Bacteria | 5364 |
| 134 | Ga0466704_055823 | 3300042643 | Bacteria | 9511 |
| 135 | Ga0466704_371943 | 3300042643 | Bacteria | 4847 |
| 136 | Ga0466708_336618 | 3300042652 | Bacteria | 3259 |
| 137 | Ga0466706_071542 | 3300042599 | Bacteria | 20453 |
| 138 | Ga0466706_139656 | 3300042599 | Bacteria | 25529 |
| 139 | Ga0466713_083937 | 3300042602 | Bacteria | 4041 |
| 140 | Ga0466719_375082 | 3300042606 | Unclassified | 3514 |
| 141 | Ga0466720_046917 | 3300042607 | Bacteria | 61630 |
| 142 | Ga0466720_065410 | 3300042607 | Bacteria | 38105 |
| 143 | Ga0466720_166206 | 3300042607 | Bacteria | 1877 |
| 144 | Ga0466721_035301 | 3300042608 | Bacteria | 11030 |
| 145 | Ga0466721_345673 | 3300042608 | Bacteria | 42375 |
| 146 | Ga0466722_188278 | 3300042609 | Bacteria | 2026 |
| 147 | AustNasuHG_c1004470 | 3300000089 | Bacteria | 5014 |
| 148 | AustNasuHG_c1013481 | 3300000089 | Bacteria | 2800 |
| 149 | Ga0072941_1204527 | 3300005201 | Bacteria | 1480 |
| 150 | Ga0466732_426335 | 3300042656 | Bacteria | 2399 |
| 151 | Ga0264413_100365 | 3300024493 | Bacteria | 60695 |
| 152 | Ga0466690_192007 | 3300042590 | Bacteria | 2622 |
| 153 | Ga0466699_219965 | 3300042597 | Bacteria | 10807 |
| 154 | Ga0466705_453582 | 3300042612 | Bacteria | 8067 |
| 155 | Ga0466712_005338 | 3300042614 | Bacteria | 40115 |
| 156 | Ga0466711_090980 | 3300042615 | Bacteria | 1811 |
| 157 | Ga0466711_441570 | 3300042615 | Bacteria | 32261 |
| 158 | Ga0466715_125292 | 3300042616 | Bacteria | 16069 |
| 159 | Ga0466715_284885 | 3300042616 | Bacteria | 5077 |
| 160 | Ga0466715_313596 | 3300042616 | Bacteria | 3383 |
| 161 | Ga0466718_151173 | 3300042617 | Bacteria | 1326 |
| 162 | Ga0466723_042783 | 3300042618 | Bacteria | 9887 |
| 163 | Ga0123357_10031509 | 3300009784 | Bacteria | 7194 |
| 164 | Ga0123355_10172701 | 3300009826 | Bacteria | 3226 |
| 165 | Ga0123356_10211888 | 3300010049 | Bacteria | 1987 |
| 166 | Ga0466734_162556 | 3300042623 | Bacteria | 55959 |
| 167 | Ga0466735_075316 | 3300042624 | Bacteria | 4292 |
| 168 | Ga0466704_002548 | 3300042643 | Bacteria | 2291 |
| 169 | Ga0466709_065614 | 3300042648 | Bacteria | 7551 |
| 170 | Ga0466713_056590 | 3300042602 | Bacteria | 57816 |
| 171 | Ga0466720_046723 | 3300042607 | Bacteria | 3852 |
| 172 | Ga0466720_117094 | 3300042607 | Bacteria | 9707 |
| 173 | Ga0466720_128273 | 3300042607 | Bacteria | 13102 |
| 174 | Ga0466720_178452 | 3300042607 | Bacteria | 61615 |
| 175 | JGI24698J34947_10009922 | 3300002449 | Bacteria | 5220 |
| 176 | JGI24695J34938_10000553 | 3300002450 | Bacteria | 36121 |
| 177 | JGI24695J34938_10000892 | 3300002450 | Bacteria | 27564 |
| 178 | Ga0072941_1019357 | 3300005201 | Bacteria | 12048 |
| 179 | Ga0072941_1064348 | 3300005201 | Bacteria | 4336 |
| 180 | Ga0466705_177532 | 3300042612 | Bacteria | 3199 |
| 181 | Ga0466705_289431 | 3300042612 | Bacteria | 2910 |
| 182 | Ga0415639_028320 | 3300038395 | Bacteria | 8332 |
| 183 | Ga0415639_101468 | 3300038395 | Bacteria | 8834 |
| 184 | Ga0466691_013606 | 3300042593 | Bacteria | 38402 |
| 185 | Ga0466699_163112 | 3300042597 | Bacteria | 3805 |
| 186 | Ga0466712_229612 | 3300042614 | Bacteria | 10404 |
| 187 | Ga0466711_091237 | 3300042615 | Bacteria | 11442 |
| 188 | Ga0466718_103914 | 3300042617 | Bacteria | 12354 |
| 189 | Ga0466723_213833 | 3300042618 | Bacteria | 4929 |
| 190 | Ga0466726_187644 | 3300042619 | Bacteria | 19476 |
| 191 | Ga0466726_194295 | 3300042619 | Bacteria | 21045 |
| 192 | Ga0466728_086301 | 3300042620 | Bacteria | 5970 |
| 193 | Ga0123353_10038022 | 3300010167 | Unclassified | 7558 |
| 194 | Ga0466703_005213 | 3300042636 | Bacteria | 2169 |
| 195 | Ga0466703_230293 | 3300042636 | Bacteria | 3370 |
| 196 | Ga0466703_253396 | 3300042636 | Bacteria | 5983 |
| 197 | Ga0466704_013206 | 3300042643 | Bacteria | 10059 |
| 198 | Ga0466704_149995 | 3300042643 | Bacteria | 11761 |
| 199 | Ga0466708_170218 | 3300042652 | Bacteria | 5829 |
| 200 | Ga0466707_043716 | 3300042601 | Bacteria | 4092 |
| 201 | Ga0466707_310128 | 3300042601 | Bacteria | 1512 |
| 202 | Ga0466714_117775 | 3300042603 | Bacteria | 2462 |
| 203 | Ga0466716_039352 | 3300042605 | Bacteria | 2297 |
| 204 | Ga0466716_500725 | 3300042605 | Bacteria | 24017 |
| 205 | Ga0466719_566456 | 3300042606 | Bacteria | 2316 |
| 206 | Ga0466721_329730 | 3300042608 | Bacteria | 3342 |
| 207 | AustNasuHG_c1007902 | 3300000089 | Bacteria | 3772 |
| 208 | AustNasuHG_c1026234 | 3300000089 | Bacteria | 1818 |
| 209 | JGI24698J34947_10000037 | 3300002449 | Bacteria | 37292 |
| 210 | JGI24698J34947_10007319 | 3300002449 | Bacteria | 6065 |
| 211 | JGI24698J34947_10014969 | 3300002449 | Bacteria | 4224 |
| 212 | JGI24698J34947_10015987 | 3300002449 | Bacteria | 4080 |
| 213 | JGI24695J34938_10000216 | 3300002450 | Bacteria | 55221 |
| 214 | JGI24695J34938_10000246 | 3300002450 | Bacteria | 52162 |
| 215 | JGI24702J35022_10020353 | 3300002462 | Bacteria | 3603 |
| 216 | JGI24700J35501_10930612 | 3300002508 | Bacteria | 16681 |
| 217 | JGI24696J40584_12960152 | 3300002834 | Bacteria | 6447 |
| 218 | Ga0466705_050751 | 3300042612 | Bacteria | 5414 |
| 219 | Ga0466705_339407 | 3300042612 | Bacteria | 5890 |
| 220 | Ga0264413_105469 | 3300024493 | Bacteria | 17630 |
| 221 | Ga0415639_000201 | 3300038395 | Bacteria | 30098 |
| 222 | Ga0466690_232404 | 3300042590 | Bacteria | 11020 |
| 223 | Ga0466690_308674 | 3300042590 | Bacteria | 2020 |
| 224 | Ga0466692_143992 | 3300042591 | Bacteria | 18534 |
| 225 | Ga0466691_156976 | 3300042593 | Bacteria | 2641 |
| 226 | Ga0466695_338763 | 3300042595 | Bacteria | 1951 |
| 227 | Ga0466696_111601 | 3300042596 | Bacteria | 2192 |
| 228 | Ga0466712_068745 | 3300042614 | Bacteria | 20233 |
| 229 | Ga0466712_113791 | 3300042614 | Bacteria | 12080 |
| 230 | Ga0466712_253155 | 3300042614 | Bacteria | 2918 |
| 231 | Ga0466715_582583 | 3300042616 | Bacteria | 22479 |
| 232 | Ga0466718_045655 | 3300042617 | Bacteria | 3103 |
| 233 | Ga0466723_309899 | 3300042618 | Bacteria | 7830 |
| 234 | Ga0466726_432311 | 3300042619 | Bacteria | 6491 |
| 235 | Ga0123355_10014679 | 3300009826 | Bacteria | 12264 |
| 236 | Ga0123356_10013154 | 3300010049 | Bacteria | 8001 |
| 237 | Ga0123356_10022608 | 3300010049 | Bacteria | 5934 |
| 238 | Ga0466735_074507 | 3300042624 | Bacteria | 1542 |
| 239 | Ga0466704_310606 | 3300042643 | Bacteria | 6381 |
| 240 | Ga0466704_595058 | 3300042643 | Bacteria | 10791 |
| 241 | Ga0466706_065494 | 3300042599 | Bacteria | 27814 |
| 242 | Ga0466706_203027 | 3300042599 | Bacteria | 25581 |
| 243 | Ga0466707_094742 | 3300042601 | Bacteria | 3562 |
| 244 | Ga0466707_121534 | 3300042601 | Bacteria | 30442 |
| 245 | Ga0466714_111085 | 3300042603 | Bacteria | 3225 |
| 246 | JGI24698J34947_10000210 | 3300002449 | Bacteria | 23899 |
| 247 | JGI24698J34947_10076038 | 3300002449 | Bacteria | 1594 |
| 248 | JGI24695J34938_10000934 | 3300002450 | Bacteria | 26669 |
| 249 | JGI24695J34938_10003081 | 3300002450 | Bacteria | 11925 |
| 250 | JGI24695J34938_10062605 | 3300002450 | Bacteria | 1579 |
| 251 | Ga0466705_115251 | 3300042612 | Bacteria | 13622 |
| 252 | Ga0466705_226559 | 3300042612 | Bacteria | 16010 |
| 253 | Ga0466732_112176 | 3300042656 | Bacteria | 19030 |
| 254 | Ga0466732_204179 | 3300042656 | Bacteria | 6275 |
| 255 | Ga0466733_017424 | 3300042659 | Bacteria | 26015 |
| 256 | Ga0264413_129880 | 3300024493 | Bacteria | 14819 |
| 257 | Ga0265387_1003110 | 3300024582 | Bacteria | 2322 |
| 258 | Ga0466690_091900 | 3300042590 | Bacteria | 4655 |
| 259 | Ga0466691_164394 | 3300042593 | Bacteria | 3600 |
| 260 | Ga0466705_480120 | 3300042612 | Bacteria | 4562 |
| 261 | Ga0466711_195488 | 3300042615 | Bacteria | 13064 |
| 262 | Ga0466718_063448 | 3300042617 | Bacteria | 4764 |
| 263 | Ga0466723_043143 | 3300042618 | Bacteria | 3215 |
| 264 | Ga0466728_253284 | 3300042620 | Bacteria | 17533 |
| 265 | Ga0123357_10341110 | 3300009784 | Bacteria | 1448 |
| 266 | Ga0466735_226810 | 3300042624 | Bacteria | 7800 |
| 267 | Ga0466708_285463 | 3300042652 | Unclassified | 2073 |
| 268 | Ga0466727_194672 | 3300042655 | Bacteria | 2249 |
| 269 | Ga0466706_143269 | 3300042599 | Bacteria | 3477 |
| 270 | Ga0466713_110375 | 3300042602 | Bacteria | 2910 |
| 271 | Ga0466720_022839 | 3300042607 | Bacteria | 3904 |
| 272 | Ga0466722_252418 | 3300042609 | Bacteria | 17603 |
| 273 | Ga0072941_1099617 | 3300005201 | Bacteria | 3563 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01041 | DegT_DnrJ_EryC1 | DegT/DnrJ/EryC1/StrS aminotransferase family | 48 | 424 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.