Protein Family IF10206
Metagenome
Isolate
121
Members
50
Samples
118
Scaffolds
377.96
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_320916|Ga0466727_320916_1643_2887
- Length
- 414 aa
- Sequence
- VEVTTSNFRIKKNPVHPRFFTIFIEILSICTIFAPMNLQIYITKIARFMPGQPVENDDMESRLGMIKDRPSLARRIVLRNNGIRQRYYALDRHGNVTHTNVQMAGNAIRALCEGTLPVDDIELISAGTASPEQIMPSHGVMVHGNVGGRNAEVVTFAGSCCTGVQALKYAWLSLAAGDRNNAVCVASERLSAWMRASYFEEEAALLEQLEKRPVIAFEKEFLRWMLSDGAAALLLQKQPATDGLSLRIEWIDLCSYAHVREVCMYAGGEKNPQGELVGWSMMPENEWLSKSLFSLRQDTRMLGENITKLGREFFVETVRRRNLDVNEIDWFLPHLSSMYFRDAIRTELDGCGNHIPEEKWFLNLPTVGNVASVSNFLMLEELWREGKLVKGQKILLLVPESARFSYCISLLTVC
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
29.8%
Unclassified
10.6%
Termopsidae
8.5%
Rhinotermitidae
4.3%
Passalidae
4.3%
Elmidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
1
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 2 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 3 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 4 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 15 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 18 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 37 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 38 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_180743 | 3300042615 | Bacteria | 7308 |
| 2 | Ga0466715_397728 | 3300042616 | Bacteria | 15873 |
| 3 | Ga0466728_423911 | 3300042620 | Bacteria | 14870 |
| 4 | Ga0466707_054129 | 3300042601 | Bacteria | 3220 |
| 5 | Ga0466719_173028 | 3300042606 | Unclassified | 6242 |
| 6 | Ga0466719_293286 | 3300042606 | Bacteria | 11074 |
| 7 | JGI24702J35022_10043316 | 3300002462 | Unclassified | 2397 |
| 8 | Ga0123357_10009310 | 3300009784 | Bacteria | 12384 |
| 9 | Ga0123356_10136265 | 3300010049 | Bacteria | 2414 |
| 10 | Ga0466694_009775 | 3300042594 | Bacteria | 1407 |
| 11 | Ga0466696_250786 | 3300042596 | Bacteria | 1812 |
| 12 | Ga0466703_405257 | 3300042636 | Bacteria | 23623 |
| 13 | Ga0466709_012041 | 3300042648 | Bacteria | 17191 |
| 14 | Ga0466728_420456 | 3300042620 | Bacteria | 14778 |
| 15 | Ga0466719_075902 | 3300042606 | Bacteria | 8360 |
| 16 | Ga0466719_474009 | 3300042606 | Bacteria | 3681 |
| 17 | Ga0466722_048122 | 3300042609 | Bacteria | 7954 |
| 18 | JGI24702J35022_10002898 | 3300002462 | Bacteria | 10390 |
| 19 | Ga0123356_10065521 | 3300010049 | Bacteria | 3399 |
| 20 | Ga0466656_230275 | 3300042550 | Bacteria | 41300 |
| 21 | Ga0466690_059894 | 3300042590 | Bacteria | 21271 |
| 22 | Ga0466690_312485 | 3300042590 | Bacteria | 2485 |
| 23 | Ga0466731_039970 | 3300042622 | Bacteria | 1938 |
| 24 | Ga0466734_071862 | 3300042623 | Bacteria | 2407 |
| 25 | Ga0466704_110603 | 3300042643 | Bacteria | 1530 |
| 26 | Ga0466704_523022 | 3300042643 | Bacteria | 38563 |
| 27 | Ga0466725_367336 | 3300042654 | Bacteria | 12007 |
| 28 | Ga0466727_038263 | 3300042655 | Bacteria | 3141 |
| 29 | Ga0466705_328630 | 3300042612 | Bacteria | 11290 |
| 30 | Ga0466715_093845 | 3300042616 | Bacteria | 8607 |
| 31 | Ga0466726_171137 | 3300042619 | Bacteria | 8351 |
| 32 | Ga0466729_037321 | 3300042621 | Bacteria | 9309 |
| 33 | Ga0466701_101843 | 3300042598 | Bacteria | 1994 |
| 34 | Ga0466713_106609 | 3300042602 | Bacteria | 5617 |
| 35 | Ga0466713_144989 | 3300042602 | Bacteria | 26601 |
| 36 | Ga0466716_128812 | 3300042605 | Bacteria | 10247 |
| 37 | Ga0466697_030624 | 3300042611 | Bacteria | 3522 |
| 38 | Ga0068305_10046749 | 3300005083 | Bacteria | 15173 |
| 39 | Ga0123353_10244527 | 3300010167 | Bacteria | 2785 |
| 40 | Ga0466656_355545 | 3300042550 | Bacteria | 1574 |
| 41 | Ga0466690_345339 | 3300042590 | Bacteria | 11200 |
| 42 | Ga0466690_425328 | 3300042590 | Bacteria | 20328 |
| 43 | Ga0466694_303015 | 3300042594 | Unclassified | 1300 |
| 44 | Ga0466729_242331 | 3300042621 | Bacteria | 6461 |
| 45 | Ga0466704_412312 | 3300042643 | Bacteria | 7914 |
| 46 | Ga0466725_259771 | 3300042654 | Bacteria | 67209 |
| 47 | Ga0466727_095699 | 3300042655 | Bacteria | 5417 |
| 48 | Ga0466727_314555 | 3300042655 | Bacteria | 21280 |
| 49 | Ga0466705_091793 | 3300042612 | Bacteria | 13283 |
| 50 | Ga0466715_631189 | 3300042616 | Archaea | 5698 |
| 51 | Ga0466728_479280 | 3300042620 | Unclassified | 1374 |
| 52 | Ga0466714_090515 | 3300042603 | Bacteria | 55724 |
| 53 | Ga0466719_190941 | 3300042606 | Bacteria | 6420 |
| 54 | Ga0123353_10239433 | 3300010167 | Unclassified | 2821 |
| 55 | Ga0466657_250403 | 3300042582 | Unclassified | 1455 |
| 56 | Ga0466691_061439 | 3300042593 | Bacteria | 8911 |
| 57 | Ga0466691_214132 | 3300042593 | Bacteria | 39556 |
| 58 | Ga0466699_157218 | 3300042597 | Bacteria | 2227 |
| 59 | Ga0466735_013652 | 3300042624 | Bacteria | 4210 |
| 60 | Ga0466708_301949 | 3300042652 | Bacteria | 21510 |
| 61 | Ga0466733_107037 | 3300042659 | Bacteria | 20789 |
| 62 | Ga0466711_114185 | 3300042615 | Bacteria | 5348 |
| 63 | Ga0466715_096986 | 3300042616 | Bacteria | 12819 |
| 64 | Ga0466726_016624 | 3300042619 | Bacteria | 5372 |
| 65 | Ga0466728_134156 | 3300042620 | Bacteria | 13245 |
| 66 | Ga0466701_031730 | 3300042598 | Bacteria | 202867 |
| 67 | Ga0466716_389534 | 3300042605 | Bacteria | 7339 |
| 68 | IMNBL1DRAFT_c0002502 | 3300000062 | Unclassified | 12740 |
| 69 | Ga0466731_142565 | 3300042622 | Bacteria | 2422 |
| 70 | Ga0466733_003794 | 3300042659 | Bacteria | 34484 |
| 71 | Ga0466707_069919 | 3300042601 | Bacteria | 7241 |
| 72 | Ga0466713_082710 | 3300042602 | Bacteria | 5603 |
| 73 | Ga0466714_086953 | 3300042603 | Bacteria | 52249 |
| 74 | Ga0466716_256567 | 3300042605 | Bacteria | 7977 |
| 75 | Ga0466719_113428 | 3300042606 | Bacteria | 10674 |
| 76 | Ga0466722_163672 | 3300042609 | Bacteria | 3221 |
| 77 | Ga0466722_194852 | 3300042609 | Bacteria | 7088 |
| 78 | JGI24702J35022_10005827 | 3300002462 | Bacteria | 7165 |
| 79 | JGI24705J35276_12238737 | 3300002504 | Bacteria | 48270 |
| 80 | Ga0068302_10162501 | 3300005071 | Bacteria | 9312 |
| 81 | Ga0160442_100257 | 3300012806 | Unclassified | 34158 |
| 82 | Ga0466735_013006 | 3300042624 | Bacteria | 2870 |
| 83 | Ga0466703_041834 | 3300042636 | Bacteria | 15244 |
| 84 | Ga0466723_306490 | 3300042618 | Bacteria | 16637 |
| 85 | Ga0466729_135321 | 3300042621 | Bacteria | 4229 |
| 86 | Ga0466706_205904 | 3300042599 | Bacteria | 63886 |
| 87 | Ga0466707_225293 | 3300042601 | Bacteria | 2220 |
| 88 | Ga0466707_391514 | 3300042601 | Bacteria | 1893 |
| 89 | Ga0466713_046573 | 3300042602 | Bacteria | 48292 |
| 90 | Ga0466713_104146 | 3300042602 | Bacteria | 2834 |
| 91 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 92 | IMNBL1DRAFT_c0004517 | 3300000062 | Bacteria | 8317 |
| 93 | JGI24705J35276_12194080 | 3300002504 | Bacteria | 1507 |
| 94 | Ga0160453_101313 | 3300012814 | Bacteria | 9190 |
| 95 | Ga0466699_398073 | 3300042597 | Bacteria | 2400 |
| 96 | Ga0466703_226878 | 3300042636 | Bacteria | 12074 |
| 97 | Ga0466705_093546 | 3300042612 | Bacteria | 7799 |
| 98 | Ga0466733_175448 | 3300042659 | Bacteria | 12342 |
| 99 | Ga0466711_267178 | 3300042615 | Bacteria | 15544 |
| 100 | Ga0466715_105923 | 3300042616 | Bacteria | 7238 |
| 101 | Ga0466715_194920 | 3300042616 | Bacteria | 3545 |
| 102 | Ga0466718_106005 | 3300042617 | Bacteria | 3962 |
| 103 | Ga0466723_104160 | 3300042618 | Bacteria | 7219 |
| 104 | Ga0466723_122680 | 3300042618 | Bacteria | 21397 |
| 105 | Ga0466700_122917 | 3300042600 | Bacteria | 6223 |
| 106 | 2227569084 | 2225789004 | Unclassified | 13975 |
| 107 | JGI24705J35276_12194435 | 3300002504 | Bacteria | 1512 |
| 108 | Ga0068305_10034324 | 3300005083 | Unclassified | 5220 |
| 109 | Ga0072941_1106857 | 3300005201 | Bacteria | 4084 |
| 110 | Ga0466656_289303 | 3300042550 | Bacteria | 1494 |
| 111 | Ga0466691_036704 | 3300042593 | Bacteria | 9460 |
| 112 | Ga0466696_091020 | 3300042596 | Bacteria | 13584 |
| 113 | Ga0466696_360550 | 3300042596 | Bacteria | 3559 |
| 114 | Ga0466734_016420 | 3300042623 | Unclassified | 1980 |
| 115 | Ga0466735_175354 | 3300042624 | Unclassified | 4038 |
| 116 | Ga0466704_055265 | 3300042643 | Bacteria | 9181 |
| 117 | Ga0466704_233148 | 3300042643 | Bacteria | 8550 |
| 118 | Ga0466727_320916 | 3300042655 | Bacteria | 11022 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08541 | ACP_syn_III_C | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal | 320 | 397 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.