Protein Family IF10197
Metagenome
Isolate
197
Members
57
Samples
185
Scaffolds
490.82
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_302825|Ga0466727_302825_89_1726
- Length
- 545 aa
- Sequence
- LTVKEKRCTALFFGKLTATSFGSFATSFFSKKIRCNFAPDFYYFIQIIMAYKKITAEEAAQLIKNDDVIGFSGFTAAGCPKVVTKALAKRAEEEHAKGNPLKIGIYTGASTGDSIDGALARAHAIKFRSPYQSNKDLRTELNNRDAHYFDLHLSELAQYLRYGFLERPNWAILEACDITEDGKVYLTSAVGIAPTVARLADHIVIELNQYHPKELAGMHDIYEPADPPKRREIPVYSPSDRIGTPYLQIDPKKVVGIVDTNLPNEVGAFTPSDEVTNQIGKNVAGFLSSEIKAGRIPASFLPVQSGVGNVANAVLGAMGENEDIPPFEIYTEVIQDSVIKLMQDGNVKFASGCSLTLSTPALENVYENLAEFKSKLLLRPQEISNSPELARRMGLISINTALEADIFGNINSTHVLGTKMMNGIGGSGDFCRNAFLSIFTTPSIAKEGKISAIVPMVSHLDHSEHSVKILITEHGIADLRGKSPIQRAEEIINNCVAPQYKGLLREYLKLGQKGHTPQNMSAALAFHDTFIKTGDMSQVNWENYK
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.1%
Kalotermitidae
25.0%
Unclassified
19.6%
Blattidae
7.1%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Passalidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
189
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 25 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 34 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 51 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 54 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 55 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_175096 | 3300042612 | Bacteria | 32654 |
| 2 | Ga0466706_217108 | 3300042599 | Bacteria | 6516 |
| 3 | Ga0466700_052954 | 3300042600 | Bacteria | 9411 |
| 4 | Ga0466707_377635 | 3300042601 | Bacteria | 12151 |
| 5 | Ga0466690_004052 | 3300042590 | Unclassified | 11857 |
| 6 | Ga0466690_171877 | 3300042590 | Bacteria | 3907 |
| 7 | Ga0466696_050124 | 3300042596 | Bacteria | 20961 |
| 8 | Ga0466705_517123 | 3300042612 | Bacteria | 11084 |
| 9 | Ga0466711_176231 | 3300042615 | Bacteria | 10764 |
| 10 | Ga0466711_328046 | 3300042615 | Bacteria | 10660 |
| 11 | Ga0466715_065243 | 3300042616 | Bacteria | 4274 |
| 12 | Ga0466735_045098 | 3300042624 | Bacteria | 6110 |
| 13 | Ga0466735_098185 | 3300042624 | Bacteria | 4584 |
| 14 | Ga0466703_132998 | 3300042636 | Bacteria | 24818 |
| 15 | Ga0466703_258898 | 3300042636 | Bacteria | 4796 |
| 16 | Ga0466708_072313 | 3300042652 | Bacteria | 12841 |
| 17 | Ga0466727_219301 | 3300042655 | Unclassified | 2103 |
| 18 | Ga0466701_079500 | 3300042598 | Bacteria | 18987 |
| 19 | Ga0466716_101932 | 3300042605 | Bacteria | 5890 |
| 20 | Ga0466719_163244 | 3300042606 | Bacteria | 2808 |
| 21 | Ga0466722_064746 | 3300042609 | Bacteria | 2447 |
| 22 | Ga0466690_138394 | 3300042590 | Bacteria | 16005 |
| 23 | Ga0466696_214654 | 3300042596 | Bacteria | 2571 |
| 24 | Ga0123357_10025010 | 3300009784 | Bacteria | 8049 |
| 25 | Ga0123354_10000991 | 3300010882 | Bacteria | 32314 |
| 26 | Ga0123354_10020549 | 3300010882 | Bacteria | 10388 |
| 27 | Ga0123354_10042411 | 3300010882 | Bacteria | 7013 |
| 28 | Ga0123354_10166008 | 3300010882 | Bacteria | 2595 |
| 29 | Ga0466715_384156 | 3300042616 | Bacteria | 12865 |
| 30 | Ga0466729_146389 | 3300042621 | Bacteria | 2710 |
| 31 | Ga0466735_104954 | 3300042624 | Bacteria | 2314 |
| 32 | Ga0466735_125753 | 3300042624 | Bacteria | 3333 |
| 33 | Ga0466735_203743 | 3300042624 | Bacteria | 3027 |
| 34 | Ga0466703_058748 | 3300042636 | Bacteria | 9160 |
| 35 | Ga0466703_327537 | 3300042636 | Bacteria | 2037 |
| 36 | Ga0466704_129209 | 3300042643 | Bacteria | 3056 |
| 37 | Ga0466704_145587 | 3300042643 | Unclassified | 31424 |
| 38 | Ga0466727_081454 | 3300042655 | Bacteria | 2403 |
| 39 | Ga0466727_116386 | 3300042655 | Bacteria | 8479 |
| 40 | Ga0466705_106608 | 3300042612 | Bacteria | 6137 |
| 41 | Ga0466716_070236 | 3300042605 | Bacteria | 6353 |
| 42 | Ga0466722_112312 | 3300042609 | Bacteria | 19782 |
| 43 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 44 | Ga0466690_076732 | 3300042590 | Unclassified | 3304 |
| 45 | Ga0466690_109982 | 3300042590 | Bacteria | 42880 |
| 46 | Ga0466692_040598 | 3300042591 | Bacteria | 5314 |
| 47 | Ga0123357_10183770 | 3300009784 | Bacteria | 2432 |
| 48 | Ga0123356_10035555 | 3300010049 | Bacteria | 4654 |
| 49 | Ga0123353_10000120 | 3300010167 | Bacteria | 93172 |
| 50 | Ga0123357_10001096 | 3300009784 | Bacteria | 28022 |
| 51 | Ga0123357_10003319 | 3300009784 | Bacteria | 18391 |
| 52 | Ga0466711_056243 | 3300042615 | Bacteria | 13739 |
| 53 | Ga0466715_045705 | 3300042616 | Bacteria | 11443 |
| 54 | Ga0466715_546483 | 3300042616 | Bacteria | 18843 |
| 55 | Ga0466715_550706 | 3300042616 | Bacteria | 11761 |
| 56 | Ga0466723_301979 | 3300042618 | Bacteria | 2148 |
| 57 | Ga0466726_350838 | 3300042619 | Bacteria | 7791 |
| 58 | Ga0466729_155206 | 3300042621 | Bacteria | 1878 |
| 59 | Ga0466735_050358 | 3300042624 | Bacteria | 9507 |
| 60 | Ga0466704_113211 | 3300042643 | Bacteria | 20850 |
| 61 | Ga0466700_233863 | 3300042600 | Bacteria | 3878 |
| 62 | Ga0466700_478773 | 3300042600 | Bacteria | 4417 |
| 63 | Ga0466707_073185 | 3300042601 | Unclassified | 7467 |
| 64 | Ga0466713_065740 | 3300042602 | Bacteria | 4316 |
| 65 | Ga0466713_143507 | 3300042602 | Bacteria | 11210 |
| 66 | Ga0466714_162103 | 3300042603 | Bacteria | 35358 |
| 67 | Ga0466722_197625 | 3300042609 | Bacteria | 7732 |
| 68 | Ga0466692_184355 | 3300042591 | Bacteria | 12681 |
| 69 | Ga0466691_088234 | 3300042593 | Bacteria | 133743 |
| 70 | Ga0123357_10017653 | 3300009784 | Bacteria | 9453 |
| 71 | Ga0123354_10136553 | 3300010882 | Bacteria | 3062 |
| 72 | Ga0123354_10140097 | 3300010882 | Bacteria | 2998 |
| 73 | IMNBL1DRAFT_c0003213 | 3300000062 | Bacteria | 10683 |
| 74 | JGI24699J35502_11133974 | 3300002509 | Bacteria | 22272 |
| 75 | JGI24696J40584_12959592 | 3300002834 | Bacteria | 5347 |
| 76 | Ga0072941_1527007 | 3300005201 | Bacteria | 2102 |
| 77 | Ga0466715_101154 | 3300042616 | Bacteria | 18269 |
| 78 | Ga0466715_405663 | 3300042616 | Bacteria | 18925 |
| 79 | Ga0466723_006195 | 3300042618 | Bacteria | 9413 |
| 80 | Ga0466726_442562 | 3300042619 | Bacteria | 24934 |
| 81 | Ga0466728_112789 | 3300042620 | Bacteria | 14570 |
| 82 | Ga0466735_162187 | 3300042624 | Bacteria | 2050 |
| 83 | Ga0466703_113752 | 3300042636 | Bacteria | 45034 |
| 84 | Ga0466703_142164 | 3300042636 | Bacteria | 6140 |
| 85 | Ga0466703_242016 | 3300042636 | Bacteria | 4155 |
| 86 | Ga0466709_079354 | 3300042648 | Bacteria | 5238 |
| 87 | Ga0466705_338023 | 3300042612 | Bacteria | 7679 |
| 88 | Ga0466701_052963 | 3300042598 | Bacteria | 41459 |
| 89 | Ga0466707_232641 | 3300042601 | Bacteria | 41634 |
| 90 | Ga0466713_021600 | 3300042602 | Bacteria | 3948 |
| 91 | Ga0466719_011720 | 3300042606 | Bacteria | 2980 |
| 92 | Ga0466719_257731 | 3300042606 | Bacteria | 16904 |
| 93 | Ga0466696_194787 | 3300042596 | Bacteria | 14213 |
| 94 | IMNBL1DRAFT_c0025105 | 3300000062 | Bacteria | 2292 |
| 95 | JGI24699J35502_11131564 | 3300002509 | Bacteria | 5816 |
| 96 | Ga0123357_10001409 | 3300009784 | Bacteria | 25443 |
| 97 | Ga0466723_041933 | 3300042618 | Bacteria | 18221 |
| 98 | Ga0466728_069051 | 3300042620 | Bacteria | 14732 |
| 99 | Ga0466735_171760 | 3300042624 | Bacteria | 3382 |
| 100 | Ga0466703_101316 | 3300042636 | Bacteria | 3921 |
| 101 | Ga0466709_177105 | 3300042648 | Bacteria | 35753 |
| 102 | Ga0466732_161312 | 3300042656 | Bacteria | 40269 |
| 103 | Ga0466733_093649 | 3300042659 | Bacteria | 3130 |
| 104 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 105 | Ga0466707_050522 | 3300042601 | Bacteria | 1874 |
| 106 | Ga0466707_136298 | 3300042601 | Bacteria | 30628 |
| 107 | Ga0466713_068672 | 3300042602 | Bacteria | 133468 |
| 108 | Ga0466716_373889 | 3300042605 | Bacteria | 10551 |
| 109 | Ga0466722_021201 | 3300042609 | Bacteria | 9615 |
| 110 | Ga0466722_169457 | 3300042609 | Bacteria | 4821 |
| 111 | Ga0466690_129095 | 3300042590 | Bacteria | 5304 |
| 112 | Ga0466691_044225 | 3300042593 | Bacteria | 8455 |
| 113 | Ga0466691_211175 | 3300042593 | Unclassified | 5868 |
| 114 | Ga0123357_10008793 | 3300009784 | Bacteria | 12667 |
| 115 | Ga0123355_10027211 | 3300009826 | Bacteria | 9233 |
| 116 | Ga0123356_10010218 | 3300010049 | Bacteria | 9231 |
| 117 | Ga0123353_10002330 | 3300010167 | Bacteria | 23620 |
| 118 | Ga0123353_10277401 | 3300010167 | Bacteria | 2577 |
| 119 | Ga0123353_10399956 | 3300010167 | Bacteria | 2045 |
| 120 | Ga0068305_10415775 | 3300005083 | Bacteria | 3128 |
| 121 | Ga0466711_010261 | 3300042615 | Bacteria | 26630 |
| 122 | Ga0466715_582778 | 3300042616 | Bacteria | 14448 |
| 123 | Ga0466723_073883 | 3300042618 | Bacteria | 10153 |
| 124 | Ga0466723_219467 | 3300042618 | Bacteria | 13446 |
| 125 | Ga0466723_355141 | 3300042618 | Bacteria | 11770 |
| 126 | Ga0466728_058988 | 3300042620 | Bacteria | 29164 |
| 127 | Ga0466703_049405 | 3300042636 | Bacteria | 6589 |
| 128 | Ga0466703_338442 | 3300042636 | Bacteria | 4023 |
| 129 | Ga0466704_565564 | 3300042643 | Bacteria | 28607 |
| 130 | Ga0466709_000274 | 3300042648 | Bacteria | 16787 |
| 131 | Ga0466708_199202 | 3300042652 | Bacteria | 16986 |
| 132 | Ga0466708_337866 | 3300042652 | Bacteria | 5019 |
| 133 | Ga0466708_361464 | 3300042652 | Bacteria | 9570 |
| 134 | Ga0466725_442772 | 3300042654 | Bacteria | 25386 |
| 135 | Ga0466697_172135 | 3300042611 | Bacteria | 2438 |
| 136 | Ga0466705_045791 | 3300042612 | Bacteria | 26557 |
| 137 | Ga0466707_183678 | 3300042601 | Bacteria | 8035 |
| 138 | Ga0466719_414090 | 3300042606 | Bacteria | 7663 |
| 139 | Ga0466692_090996 | 3300042591 | Bacteria | 32249 |
| 140 | Ga0466693_125699 | 3300042592 | Bacteria | 1911 |
| 141 | Ga0466691_001999 | 3300042593 | Bacteria | 5983 |
| 142 | Ga0466696_350726 | 3300042596 | Bacteria | 10131 |
| 143 | Ga0123353_10399283 | 3300010167 | Bacteria | 2047 |
| 144 | Ga0123354_10015129 | 3300010882 | Bacteria | 12033 |
| 145 | Ga0123354_10079287 | 3300010882 | Bacteria | 4660 |
| 146 | 2227155791 | 2225789004 | Bacteria | 8477 |
| 147 | 2227325230 | 2225789004 | Bacteria | 6372 |
| 148 | IMNBL1DRAFT_c0000805 | 3300000062 | Bacteria | 24698 |
| 149 | IMNBL1DRAFT_c0001493 | 3300000062 | Bacteria | 17437 |
| 150 | JGI24705J35276_12222035 | 3300002504 | Bacteria | 2387 |
| 151 | Ga0466711_343758 | 3300042615 | Bacteria | 3362 |
| 152 | Ga0466715_232113 | 3300042616 | Bacteria | 3549 |
| 153 | Ga0466723_167541 | 3300042618 | Bacteria | 38557 |
| 154 | Ga0466728_186186 | 3300042620 | Bacteria | 11725 |
| 155 | Ga0466729_185722 | 3300042621 | Bacteria | 4419 |
| 156 | Ga0466734_132994 | 3300042623 | Bacteria | 2161 |
| 157 | Ga0466703_268591 | 3300042636 | Bacteria | 7731 |
| 158 | Ga0466704_433222 | 3300042643 | Bacteria | 27622 |
| 159 | Ga0466708_074679 | 3300042652 | Bacteria | 22411 |
| 160 | Ga0466727_034281 | 3300042655 | Bacteria | 3015 |
| 161 | Ga0466727_302825 | 3300042655 | Bacteria | 1910 |
| 162 | Ga0466705_092633 | 3300042612 | Bacteria | 28689 |
| 163 | Ga0466705_235584 | 3300042612 | Bacteria | 1916 |
| 164 | Ga0466706_133211 | 3300042599 | Bacteria | 3483 |
| 165 | Ga0466707_144707 | 3300042601 | Bacteria | 2053 |
| 166 | Ga0466714_148745 | 3300042603 | Bacteria | 6334 |
| 167 | Ga0466716_059168 | 3300042605 | Bacteria | 5752 |
| 168 | Ga0466722_268486 | 3300042609 | Bacteria | 2101 |
| 169 | Ga0466696_014207 | 3300042596 | Bacteria | 6439 |
| 170 | Ga0466696_159649 | 3300042596 | Bacteria | 13088 |
| 171 | Ga0466696_375260 | 3300042596 | Bacteria | 12113 |
| 172 | Ga0123354_10000494 | 3300010882 | Bacteria | 39538 |
| 173 | Ga0123354_10057460 | 3300010882 | Bacteria | 5793 |
| 174 | Ga0123354_10211967 | 3300010882 | Unclassified | 2090 |
| 175 | 2227555740 | 2225789004 | Bacteria | 2791 |
| 176 | JGI24702J35022_10002190 | 3300002462 | Bacteria | 12032 |
| 177 | Ga0068305_10130983 | 3300005083 | Unclassified | 2032 |
| 178 | Ga0466715_058785 | 3300042616 | Bacteria | 6906 |
| 179 | Ga0466715_163266 | 3300042616 | Bacteria | 6579 |
| 180 | Ga0466726_044030 | 3300042619 | Bacteria | 4771 |
| 181 | Ga0466726_057843 | 3300042619 | Bacteria | 10697 |
| 182 | Ga0466728_414517 | 3300042620 | Bacteria | 3958 |
| 183 | Ga0466735_180447 | 3300042624 | Bacteria | 2525 |
| 184 | Ga0466704_021218 | 3300042643 | Bacteria | 6130 |
| 185 | Ga0466709_403996 | 3300042648 | Bacteria | 22459 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02550 | GO:0008410 | CoA-transferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.