Protein Family IF10179
Metagenome
Isolate
150
Members
52
Samples
144
Scaffolds
196.69
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_255823|Ga0466727_255823_363_1049
- Length
- 228 aa
- Sequence
- VIRTAGFFLALLSSFCFFSFLVKYSQGFCMEQTLTREQAWDLLCEYNKDPFHLQHALTVEWVMKWYARDLGYEAEEEFWGNVGLLHDIDFEEYPTEHCLKAPELLRKGGVGEDTIHAVCSHGYGLTAVDAKPEHEMEKVLFASDELTGLIWAVAIIRPSKSVQDMEVKSVKKKYKTPAFAAGCSRQVIEQGAAQLGWELDKLIEKTILAMRSCESSVNAFMEKFSPKG
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.1%
Kalotermitidae
21.6%
Unclassified
15.7%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 24 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 25 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 45 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_140924 | 3300042612 | Bacteria | 10301 |
| 2 | Ga0466732_090587 | 3300042656 | Bacteria | 5490 |
| 3 | Ga0123353_10044235 | 3300010167 | Bacteria | 7057 |
| 4 | Ga0123353_11311950 | 3300010167 | Bacteria | 939 |
| 5 | Ga0466699_332200 | 3300042597 | Bacteria | 2513 |
| 6 | Ga0466712_062366 | 3300042614 | Bacteria | 14422 |
| 7 | AustNasuHG_c1007192 | 3300000089 | Bacteria | 3964 |
| 8 | JGI24698J34947_10062285 | 3300002449 | Bacteria | 1832 |
| 9 | JGI24695J34938_10002021 | 3300002450 | Bacteria | 16081 |
| 10 | Ga0072940_1286551 | 3300005200 | Bacteria | 2708 |
| 11 | Ga0072941_1015822 | 3300005201 | Bacteria | 3812 |
| 12 | Ga0466706_038359 | 3300042599 | Bacteria | 5813 |
| 13 | Ga0123356_10206140 | 3300010049 | Bacteria | 2010 |
| 14 | Ga0123353_10874406 | 3300010167 | Unclassified | 1228 |
| 15 | Ga0123354_10155486 | 3300010882 | Bacteria | 2746 |
| 16 | Ga0466692_004493 | 3300042591 | Bacteria | 2865 |
| 17 | Ga0466712_014847 | 3300042614 | Bacteria | 1187 |
| 18 | Ga0466712_088265 | 3300042614 | Bacteria | 1441 |
| 19 | Ga0466712_319590 | 3300042614 | Bacteria | 1153 |
| 20 | Ga0466723_345824 | 3300042618 | Bacteria | 10892 |
| 21 | Ga0466702_415365 | 3300042635 | Bacteria | 19600 |
| 22 | Ga0466702_424189 | 3300042635 | Bacteria | 7363 |
| 23 | Ga0466704_051116 | 3300042643 | Bacteria | 38647 |
| 24 | JGI24698J34947_10006192 | 3300002449 | Bacteria | 6573 |
| 25 | JGI24698J34947_10011081 | 3300002449 | Unclassified | 4947 |
| 26 | JGI24698J34947_10027999 | 3300002449 | Bacteria | 2987 |
| 27 | JGI24698J34947_10061310 | 3300002449 | Bacteria | 1852 |
| 28 | JGI24702J35022_10195794 | 3300002462 | Bacteria | 1154 |
| 29 | Ga0466719_056612 | 3300042606 | Bacteria | 14375 |
| 30 | Ga0466720_056703 | 3300042607 | Bacteria | 3185 |
| 31 | Ga0466722_167286 | 3300042609 | Bacteria | 5865 |
| 32 | Ga0466705_115631 | 3300042612 | Unclassified | 2932 |
| 33 | Ga0466732_108517 | 3300042656 | Bacteria | 3743 |
| 34 | Ga0123356_10018622 | 3300010049 | Bacteria | 6590 |
| 35 | Ga0123353_11304157 | 3300010167 | Bacteria | 942 |
| 36 | Ga0466696_176852 | 3300042596 | Bacteria | 16501 |
| 37 | Ga0466699_106511 | 3300042597 | Bacteria | 2261 |
| 38 | Ga0466699_138221 | 3300042597 | Bacteria | 1532 |
| 39 | Ga0466699_153142 | 3300042597 | Bacteria | 3222 |
| 40 | Ga0466699_174596 | 3300042597 | Bacteria | 11498 |
| 41 | Ga0466705_488410 | 3300042612 | Bacteria | 10114 |
| 42 | Ga0466712_025900 | 3300042614 | Bacteria | 38213 |
| 43 | Ga0466718_163659 | 3300042617 | Bacteria | 9868 |
| 44 | Ga0466723_281596 | 3300042618 | Bacteria | 2553 |
| 45 | Ga0466726_308479 | 3300042619 | Unclassified | 1987 |
| 46 | Ga0466703_111965 | 3300042636 | Bacteria | 2563 |
| 47 | Ga0466704_238697 | 3300042643 | Unclassified | 1607 |
| 48 | JGI24698J34947_10115698 | 3300002449 | Bacteria | 1174 |
| 49 | JGI24698J34947_10240116 | 3300002449 | Unclassified | 683 |
| 50 | JGI24695J34938_10018676 | 3300002450 | Unclassified | 3458 |
| 51 | Ga0466707_133800 | 3300042601 | Bacteria | 1830 |
| 52 | Ga0466713_073209 | 3300042602 | Bacteria | 4632 |
| 53 | Ga0466705_078736 | 3300042612 | Bacteria | 13359 |
| 54 | Ga0466732_384460 | 3300042656 | Bacteria | 1127 |
| 55 | Ga0123357_10065152 | 3300009784 | Bacteria | 4866 |
| 56 | Ga0123355_10010730 | 3300009826 | Bacteria | 14077 |
| 57 | Ga0466690_364640 | 3300042590 | Bacteria | 1528 |
| 58 | Ga0466691_197795 | 3300042593 | Unclassified | 5842 |
| 59 | Ga0466699_295040 | 3300042597 | Bacteria | 23711 |
| 60 | Ga0466712_008349 | 3300042614 | Bacteria | 5068 |
| 61 | Ga0466712_053811 | 3300042614 | Bacteria | 1038 |
| 62 | Ga0466712_302118 | 3300042614 | Bacteria | 6692 |
| 63 | Ga0466726_249259 | 3300042619 | Bacteria | 4653 |
| 64 | Ga0466727_222175 | 3300042655 | Bacteria | 1128 |
| 65 | Ga0466727_255823 | 3300042655 | Bacteria | 1174 |
| 66 | JGI24698J34947_10002914 | 3300002449 | Bacteria | 9280 |
| 67 | JGI24698J34947_10079502 | 3300002449 | Bacteria | 1544 |
| 68 | JGI24698J34947_10114085 | 3300002449 | Bacteria | 1186 |
| 69 | JGI24702J35022_10003947 | 3300002462 | Bacteria | 8908 |
| 70 | Ga0466706_131039 | 3300042599 | Bacteria | 5055 |
| 71 | Ga0466707_085773 | 3300042601 | Bacteria | 38135 |
| 72 | Ga0466720_003191 | 3300042607 | Bacteria | 13537 |
| 73 | Ga0466732_390422 | 3300042656 | Bacteria | 9594 |
| 74 | Ga0456237_0003879 | 3300041968 | Bacteria | 2411 |
| 75 | Ga0466693_348900 | 3300042592 | Bacteria | 12424 |
| 76 | Ga0466695_004983 | 3300042595 | Bacteria | 1026 |
| 77 | Ga0466712_042641 | 3300042614 | Bacteria | 6260 |
| 78 | Ga0466712_269306 | 3300042614 | Bacteria | 11332 |
| 79 | Ga0466718_073979 | 3300042617 | Bacteria | 1161 |
| 80 | Ga0466704_438061 | 3300042643 | Bacteria | 1867 |
| 81 | JGI24698J34947_10000352 | 3300002449 | Bacteria | 20514 |
| 82 | JGI24698J34947_10183281 | 3300002449 | Bacteria | 835 |
| 83 | Ga0072941_1263834 | 3300005201 | Bacteria | 2249 |
| 84 | Ga0466706_166079 | 3300042599 | Bacteria | 24785 |
| 85 | Ga0466720_027935 | 3300042607 | Bacteria | 23895 |
| 86 | Ga0466720_072070 | 3300042607 | Bacteria | 7003 |
| 87 | Ga0466720_116644 | 3300042607 | Bacteria | 39029 |
| 88 | Ga0466720_118379 | 3300042607 | Bacteria | 14999 |
| 89 | Ga0466712_074240 | 3300042614 | Bacteria | 4142 |
| 90 | Ga0466712_109979 | 3300042614 | Bacteria | 3554 |
| 91 | Ga0466712_129974 | 3300042614 | Unclassified | 1491 |
| 92 | Ga0466715_262210 | 3300042616 | Bacteria | 35550 |
| 93 | Ga0466723_035568 | 3300042618 | Bacteria | 13154 |
| 94 | Ga0466729_106548 | 3300042621 | Bacteria | 1750 |
| 95 | Ga0466708_162363 | 3300042652 | Unclassified | 1024 |
| 96 | Ga0466727_341054 | 3300042655 | Bacteria | 2576 |
| 97 | AustNasuHG_c1000283 | 3300000089 | Bacteria | 17536 |
| 98 | AustNasuHG_c1001608 | 3300000089 | Bacteria | 8142 |
| 99 | JGI24698J34947_10062738 | 3300002449 | Unclassified | 1824 |
| 100 | JGI24695J34938_10228556 | 3300002450 | Unclassified | 783 |
| 101 | JGI24697J35500_11256066 | 3300002507 | Bacteria | 2734 |
| 102 | Ga0466700_080770 | 3300042600 | Bacteria | 1793 |
| 103 | Ga0466707_222168 | 3300042601 | Bacteria | 110343 |
| 104 | Ga0466719_159024 | 3300042606 | Bacteria | 18310 |
| 105 | Ga0466720_025680 | 3300042607 | Bacteria | 2545 |
| 106 | Ga0466720_127163 | 3300042607 | Bacteria | 15897 |
| 107 | Ga0466720_146539 | 3300042607 | Bacteria | 24774 |
| 108 | Ga0466705_041045 | 3300042612 | Bacteria | 5788 |
| 109 | Ga0466692_017520 | 3300042591 | Unclassified | 2441 |
| 110 | Ga0466699_280461 | 3300042597 | Bacteria | 3194 |
| 111 | Ga0466712_175881 | 3300042614 | Bacteria | 1752 |
| 112 | Ga0466723_063701 | 3300042618 | Bacteria | 28262 |
| 113 | Ga0466731_279696 | 3300042622 | Bacteria | 4744 |
| 114 | Ga0466704_119111 | 3300042643 | Bacteria | 4773 |
| 115 | Ga0466727_323942 | 3300042655 | Bacteria | 9868 |
| 116 | AustNasuHG_c1038182 | 3300000089 | Bacteria | 1213 |
| 117 | JGI24698J34947_10059851 | 3300002449 | Bacteria | 1881 |
| 118 | JGI24695J34938_10002345 | 3300002450 | Bacteria | 14578 |
| 119 | Ga0072941_1004084 | 3300005201 | Bacteria | 15260 |
| 120 | Ga0466717_149152 | 3300042604 | Bacteria | 1502 |
| 121 | Ga0466716_047011 | 3300042605 | Bacteria | 5907 |
| 122 | Ga0466698_002890 | 3300042610 | Bacteria | 1086 |
| 123 | Ga0123353_10042956 | 3300010167 | Unclassified | 7156 |
| 124 | Ga0456237_0023192 | 3300041968 | Unclassified | 851 |
| 125 | Ga0466692_059395 | 3300042591 | Bacteria | 1702 |
| 126 | Ga0466694_333561 | 3300042594 | Bacteria | 2324 |
| 127 | Ga0466699_011643 | 3300042597 | Bacteria | 11333 |
| 128 | Ga0466705_402282 | 3300042612 | Bacteria | 1886 |
| 129 | Ga0466718_110434 | 3300042617 | Bacteria | 9377 |
| 130 | Ga0466723_093205 | 3300042618 | Bacteria | 2988 |
| 131 | Ga0466726_073931 | 3300042619 | Bacteria | 1193 |
| 132 | Ga0466729_291568 | 3300042621 | Bacteria | 1190 |
| 133 | Ga0466735_210558 | 3300042624 | Bacteria | 2139 |
| 134 | Ga0466702_125525 | 3300042635 | Bacteria | 1325 |
| 135 | Ga0466702_465252 | 3300042635 | Bacteria | 1901 |
| 136 | JGI24698J34947_10026334 | 3300002449 | Bacteria | 3090 |
| 137 | JGI24698J34947_10050564 | 3300002449 | Unclassified | 2096 |
| 138 | JGI24695J34938_10004309 | 3300002450 | Bacteria | 9375 |
| 139 | Ga0466706_277346 | 3300042599 | Bacteria | 1196 |
| 140 | Ga0466707_095212 | 3300042601 | Bacteria | 1602 |
| 141 | Ga0466720_150307 | 3300042607 | Bacteria | 2132 |
| 142 | Ga0466720_181567 | 3300042607 | Unclassified | 4126 |
| 143 | Ga0466722_222005 | 3300042609 | Bacteria | 8775 |
| 144 | Ga0466698_203251 | 3300042610 | Bacteria | 1060 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.