Protein Family IF10138
Metagenome
Isolate
222
Members
68
Samples
203
Scaffolds
84.86
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_095752|Ga0466727_095752_390_701
- Length
- 103 aa
- Sequence
- MGYDFIEFCEHQHFIFFARMANIKSAIKRIRQDQKRRLHNRYYARTARNAVKALRNTTDKAAAAAMLPKVARMVDKLAKISVIHKNKAGNLKSSLALHVNKLA
Sample Types
Isolate
8.6%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.8%
Kalotermitidae
20.9%
Blattidae
20.9%
Unclassified
10.4%
Termopsidae
6.0%
Rhinotermitidae
4.5%
Passalidae
3.0%
Hodotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 20 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 28 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 32 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 33 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 34 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 35 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 38 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 39 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 45 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 46 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 60 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 61 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 62 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 63 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_111018 | 3300042611 | Bacteria | 1854 |
| 2 | Ga0466697_279616 | 3300042611 | Bacteria | 2628 |
| 3 | JGI24702J35022_10045618 | 3300002462 | Bacteria | 2335 |
| 4 | JGI24696J40584_12685063 | 3300002834 | Unclassified | 723 |
| 5 | JGI24696J40584_12947106 | 3300002834 | Bacteria | 1931 |
| 6 | Ga0123353_10344215 | 3300010167 | Bacteria | 2250 |
| 7 | Ga0466715_072088 | 3300042616 | Bacteria | 72248 |
| 8 | Ga0466726_461014 | 3300042619 | Bacteria | 1963 |
| 9 | Ga0466728_242485 | 3300042620 | Bacteria | 1312 |
| 10 | Ga0466728_455680 | 3300042620 | Bacteria | 1844 |
| 11 | Ga0466706_019239 | 3300042599 | Bacteria | 7993 |
| 12 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 13 | Ga0466707_219352 | 3300042601 | Bacteria | 2172 |
| 14 | Ga0466714_093051 | 3300042603 | Bacteria | 3964 |
| 15 | Ga0466721_285831 | 3300042608 | Bacteria | 5966 |
| 16 | Ga0466690_281101 | 3300042590 | Unclassified | 1282 |
| 17 | Ga0466691_038913 | 3300042593 | Bacteria | 8066 |
| 18 | Ga0466705_003446 | 3300042612 | Bacteria | 15410 |
| 19 | Ga0466705_040804 | 3300042612 | Bacteria | 8845 |
| 20 | IMNBL1DRAFT_c0064922 | 3300000062 | Unclassified | 1078 |
| 21 | Ga0466735_081009 | 3300042624 | Bacteria | 11986 |
| 22 | Ga0466703_131281 | 3300042636 | Bacteria | 14208 |
| 23 | Ga0466704_086386 | 3300042643 | Bacteria | 5869 |
| 24 | Ga0466709_352149 | 3300042648 | Bacteria | 153873 |
| 25 | Ga0466708_102351 | 3300042652 | Bacteria | 19937 |
| 26 | Ga0466708_314854 | 3300042652 | Bacteria | 1565 |
| 27 | Ga0466725_015254 | 3300042654 | Unclassified | 1702 |
| 28 | Ga0466727_063805 | 3300042655 | Unclassified | 3752 |
| 29 | Ga0466727_095752 | 3300042655 | Bacteria | 5185 |
| 30 | Ga0123356_10015702 | 3300010049 | Bacteria | 7250 |
| 31 | Ga0123356_10067289 | 3300010049 | Unclassified | 3355 |
| 32 | Ga0123353_10036715 | 3300010167 | Bacteria | 7678 |
| 33 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 34 | Ga0466706_020766 | 3300042599 | Bacteria | 11060 |
| 35 | Ga0466706_195196 | 3300042599 | Bacteria | 2449 |
| 36 | Ga0466713_012237 | 3300042602 | Bacteria | 8194 |
| 37 | Ga0466722_210324 | 3300042609 | Bacteria | 22548 |
| 38 | Ga0466657_196099 | 3300042582 | Unclassified | 1034 |
| 39 | Ga0466690_037789 | 3300042590 | Bacteria | 15387 |
| 40 | Ga0466705_190912 | 3300042612 | Bacteria | 21170 |
| 41 | IMNBL1DRAFT_c0007053 | 3300000062 | Bacteria | 5986 |
| 42 | JGI24702J35022_10003073 | 3300002462 | Bacteria | 10092 |
| 43 | JGI24702J35022_10183850 | 3300002462 | Bacteria | 1189 |
| 44 | Ga0072941_1139547 | 3300005201 | Bacteria | 3681 |
| 45 | Ga0466735_120694 | 3300042624 | Bacteria | 1086 |
| 46 | Ga0466735_143626 | 3300042624 | Bacteria | 3267 |
| 47 | Ga0466735_144900 | 3300042624 | Bacteria | 14192 |
| 48 | Ga0466735_153070 | 3300042624 | Bacteria | 2197 |
| 49 | Ga0466735_184253 | 3300042624 | Unclassified | 1533 |
| 50 | Ga0466727_271847 | 3300042655 | Bacteria | 1742 |
| 51 | Ga0123356_10381231 | 3300010049 | Bacteria | 1543 |
| 52 | Ga0123356_13159048 | 3300010049 | Bacteria | 574 |
| 53 | Ga0466712_124204 | 3300042614 | Bacteria | 2150 |
| 54 | Ga0466711_061544 | 3300042615 | Bacteria | 3524 |
| 55 | Ga0466711_209571 | 3300042615 | Bacteria | 2332 |
| 56 | Ga0466715_385020 | 3300042616 | Bacteria | 25637 |
| 57 | Ga0466723_013739 | 3300042618 | Bacteria | 12787 |
| 58 | Ga0466723_054091 | 3300042618 | Bacteria | 7419 |
| 59 | Ga0466726_418653 | 3300042619 | Bacteria | 12621 |
| 60 | Ga0466700_133871 | 3300042600 | Bacteria | 4239 |
| 61 | Ga0466707_391700 | 3300042601 | Unclassified | 7106 |
| 62 | Ga0466717_228178 | 3300042604 | Unclassified | 1506 |
| 63 | Ga0466719_005959 | 3300042606 | Bacteria | 2626 |
| 64 | Ga0466722_124694 | 3300042609 | Bacteria | 8582 |
| 65 | Ga0466722_158864 | 3300042609 | Bacteria | 1458 |
| 66 | Ga0466692_018397 | 3300042591 | Unclassified | 2015 |
| 67 | Ga0466692_135804 | 3300042591 | Bacteria | 1350 |
| 68 | Ga0466696_085278 | 3300042596 | Bacteria | 1331 |
| 69 | Ga0466696_246647 | 3300042596 | Bacteria | 4729 |
| 70 | Ga0466732_350586 | 3300042656 | Bacteria | 1086 |
| 71 | Ga0466733_172514 | 3300042659 | Bacteria | 11636 |
| 72 | 2227239693 | 2225789004 | Bacteria | 1345 |
| 73 | 2227510741 | 2225789004 | Bacteria | 18495 |
| 74 | IMNBL1DRAFT_c0007449 | 3300000062 | Bacteria | 5754 |
| 75 | IMNBL1DRAFT_c0061274 | 3300000062 | Unclassified | 1130 |
| 76 | IMNBL1DRAFT_c0061675 | 3300000062 | Unclassified | 1123 |
| 77 | JGI24702J35022_10004710 | 3300002462 | Bacteria | 8078 |
| 78 | Ga0068302_10269254 | 3300005071 | Bacteria | 1891 |
| 79 | Ga0466704_197238 | 3300042643 | Unclassified | 2406 |
| 80 | Ga0466709_017223 | 3300042648 | Bacteria | 5610 |
| 81 | Ga0123357_10204362 | 3300009784 | Bacteria | 2239 |
| 82 | Ga0123356_10460839 | 3300010049 | Bacteria | 1421 |
| 83 | Ga0123356_11866130 | 3300010049 | Bacteria | 748 |
| 84 | Ga0123353_10004936 | 3300010167 | Bacteria | 17369 |
| 85 | Ga0466715_180890 | 3300042616 | Bacteria | 7913 |
| 86 | Ga0466726_021679 | 3300042619 | Bacteria | 6933 |
| 87 | Ga0466728_125420 | 3300042620 | Bacteria | 47830 |
| 88 | Ga0466714_028134 | 3300042603 | Bacteria | 4169 |
| 89 | Ga0466690_168964 | 3300042590 | Unclassified | 5649 |
| 90 | Ga0466691_071799 | 3300042593 | Bacteria | 28796 |
| 91 | Ga0466691_167831 | 3300042593 | Unclassified | 2925 |
| 92 | Ga0466691_173035 | 3300042593 | Unclassified | 4566 |
| 93 | Ga0466696_104530 | 3300042596 | Bacteria | 6549 |
| 94 | Ga0466696_244978 | 3300042596 | Bacteria | 67990 |
| 95 | Ga0466705_072246 | 3300042612 | Unclassified | 2453 |
| 96 | 2227487419 | 2225789004 | Bacteria | 4204 |
| 97 | IMNBL1DRAFT_c0164110 | 3300000062 | Bacteria | 566 |
| 98 | JGI24695J34938_10115829 | 3300002450 | Unclassified | 1091 |
| 99 | JGI24696J40584_12529448 | 3300002834 | Bacteria | 614 |
| 100 | Ga0466735_034194 | 3300042624 | Bacteria | 2260 |
| 101 | Ga0466735_068782 | 3300042624 | Unclassified | 3098 |
| 102 | Ga0466735_079719 | 3300042624 | Unclassified | 1334 |
| 103 | Ga0466703_108279 | 3300042636 | Bacteria | 9628 |
| 104 | Ga0466703_343131 | 3300042636 | Bacteria | 5951 |
| 105 | Ga0466704_360884 | 3300042643 | Unclassified | 1275 |
| 106 | Ga0466704_388959 | 3300042643 | Bacteria | 12802 |
| 107 | Ga0466709_009614 | 3300042648 | Bacteria | 12858 |
| 108 | Ga0466709_178910 | 3300042648 | Bacteria | 2190 |
| 109 | Ga0123356_13686992 | 3300010049 | Unclassified | 530 |
| 110 | Ga0123353_10411632 | 3300010167 | Bacteria | 2007 |
| 111 | Ga0123353_10937436 | 3300010167 | Bacteria | 1173 |
| 112 | Ga0123353_12551235 | 3300010167 | Unclassified | 606 |
| 113 | Ga0466723_106183 | 3300042618 | Bacteria | 1431 |
| 114 | Ga0466723_235253 | 3300042618 | Bacteria | 37976 |
| 115 | Ga0466726_456022 | 3300042619 | Bacteria | 1385 |
| 116 | Ga0466728_112994 | 3300042620 | Bacteria | 2501 |
| 117 | Ga0466701_055730 | 3300042598 | Bacteria | 2474 |
| 118 | Ga0466707_267526 | 3300042601 | Bacteria | 7292 |
| 119 | Ga0466714_170113 | 3300042603 | Bacteria | 59714 |
| 120 | Ga0466716_145186 | 3300042605 | Bacteria | 3566 |
| 121 | Ga0466719_035072 | 3300042606 | Bacteria | 10966 |
| 122 | Ga0466722_168509 | 3300042609 | Bacteria | 24077 |
| 123 | Ga0466692_005791 | 3300042591 | Bacteria | 8018 |
| 124 | Ga0466696_281921 | 3300042596 | Bacteria | 14088 |
| 125 | Ga0466696_387176 | 3300042596 | Bacteria | 50828 |
| 126 | Ga0466705_150477 | 3300042612 | Bacteria | 2523 |
| 127 | Ga0466705_229394 | 3300042612 | Bacteria | 6939 |
| 128 | IMNBL1DRAFT_c0027530 | 3300000062 | Bacteria | 2136 |
| 129 | JGI24696J40584_12960649 | 3300002834 | Bacteria | 7916 |
| 130 | Ga0072940_1250458 | 3300005200 | Bacteria | 1304 |
| 131 | Ga0466735_015950 | 3300042624 | Bacteria | 1393 |
| 132 | Ga0466703_149023 | 3300042636 | Bacteria | 13490 |
| 133 | Ga0466703_196675 | 3300042636 | Bacteria | 14242 |
| 134 | Ga0466708_273274 | 3300042652 | Bacteria | 23303 |
| 135 | Ga0466727_102359 | 3300042655 | Bacteria | 6438 |
| 136 | Ga0466727_307411 | 3300042655 | Bacteria | 80907 |
| 137 | Ga0123356_10731799 | 3300010049 | Bacteria | 1159 |
| 138 | Ga0466715_198882 | 3300042616 | Bacteria | 9378 |
| 139 | Ga0466715_319710 | 3300042616 | Bacteria | 3661 |
| 140 | Ga0466715_601536 | 3300042616 | Bacteria | 26750 |
| 141 | Ga0466723_080847 | 3300042618 | Bacteria | 56626 |
| 142 | Ga0466723_238293 | 3300042618 | Bacteria | 2864 |
| 143 | Ga0466723_368254 | 3300042618 | Bacteria | 13467 |
| 144 | Ga0466726_225749 | 3300042619 | Unclassified | 2838 |
| 145 | Ga0466726_441675 | 3300042619 | Bacteria | 1031 |
| 146 | Ga0466714_123520 | 3300042603 | Bacteria | 2189 |
| 147 | Ga0466716_054949 | 3300042605 | Bacteria | 5456 |
| 148 | Ga0466716_197146 | 3300042605 | Bacteria | 25568 |
| 149 | Ga0466716_312727 | 3300042605 | Bacteria | 9452 |
| 150 | Ga0466716_495033 | 3300042605 | Bacteria | 3579 |
| 151 | Ga0466722_048601 | 3300042609 | Bacteria | 4411 |
| 152 | Ga0466690_287029 | 3300042590 | Bacteria | 2163 |
| 153 | Ga0466690_410684 | 3300042590 | Bacteria | 6252 |
| 154 | Ga0466692_065020 | 3300042591 | Bacteria | 1922 |
| 155 | Ga0466691_030613 | 3300042593 | Unclassified | 1515 |
| 156 | Ga0466696_333547 | 3300042596 | Bacteria | 12618 |
| 157 | 2227330781 | 2225789004 | Bacteria | 28621 |
| 158 | IMNBL1DRAFT_c0044334 | 3300000062 | Bacteria | 1462 |
| 159 | JGI24705J35276_12237776 | 3300002504 | Bacteria | 13074 |
| 160 | Ga0466734_123867 | 3300042623 | Bacteria | 1678 |
| 161 | Ga0466735_028763 | 3300042624 | Bacteria | 1884 |
| 162 | Ga0466704_603076 | 3300042643 | Bacteria | 34589 |
| 163 | Ga0466708_073451 | 3300042652 | Unclassified | 1932 |
| 164 | Ga0466725_265027 | 3300042654 | Bacteria | 1110 |
| 165 | Ga0123356_10328802 | 3300010049 | Unclassified | 1644 |
| 166 | Ga0123354_10366374 | 3300010882 | Bacteria | 1263 |
| 167 | Ga0466715_635769 | 3300042616 | Bacteria | 2353 |
| 168 | Ga0466723_142461 | 3300042618 | Bacteria | 16321 |
| 169 | Ga0466728_060966 | 3300042620 | Unclassified | 3043 |
| 170 | Ga0466728_124326 | 3300042620 | Bacteria | 8848 |
| 171 | Ga0466706_172865 | 3300042599 | Bacteria | 71053 |
| 172 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 173 | Ga0466719_106786 | 3300042606 | Bacteria | 4236 |
| 174 | Ga0466722_045953 | 3300042609 | Bacteria | 33741 |
| 175 | Ga0456237_0042756 | 3300041968 | Bacteria | 597 |
| 176 | Ga0466657_332985 | 3300042582 | Unclassified | 1176 |
| 177 | Ga0466690_140970 | 3300042590 | Bacteria | 16689 |
| 178 | Ga0466692_176669 | 3300042591 | Bacteria | 77723 |
| 179 | Ga0466691_005486 | 3300042593 | Bacteria | 4803 |
| 180 | JGI24698J34947_10167154 | 3300002449 | Bacteria | 894 |
| 181 | Ga0466709_396263 | 3300042648 | Bacteria | 4453 |
| 182 | Ga0466708_126660 | 3300042652 | Bacteria | 12246 |
| 183 | Ga0123353_10000105 | 3300010167 | Bacteria | 97649 |
| 184 | Ga0123353_13409186 | 3300010167 | Bacteria | 504 |
| 185 | Ga0466715_056991 | 3300042616 | Bacteria | 24202 |
| 186 | Ga0466715_225443 | 3300042616 | Bacteria | 29019 |
| 187 | Ga0466715_440141 | 3300042616 | Bacteria | 22634 |
| 188 | Ga0466723_097430 | 3300042618 | Bacteria | 8973 |
| 189 | Ga0466726_013413 | 3300042619 | Bacteria | 5316 |
| 190 | Ga0466726_023702 | 3300042619 | Bacteria | 9079 |
| 191 | Ga0466701_075009 | 3300042598 | Bacteria | 10130 |
| 192 | Ga0466706_235763 | 3300042599 | Bacteria | 6253 |
| 193 | Ga0466706_252248 | 3300042599 | Bacteria | 29762 |
| 194 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 195 | Ga0466716_079748 | 3300042605 | Bacteria | 2005 |
| 196 | Ga0466719_069207 | 3300042606 | Bacteria | 1364 |
| 197 | Ga0466719_406622 | 3300042606 | Bacteria | 2617 |
| 198 | Ga0466722_028319 | 3300042609 | Bacteria | 4210 |
| 199 | Ga0466690_303937 | 3300042590 | Unclassified | 9975 |
| 200 | Ga0466691_127662 | 3300042593 | Bacteria | 7344 |
| 201 | Ga0466696_179052 | 3300042596 | Bacteria | 1275 |
| 202 | Ga0466696_188386 | 3300042596 | Unclassified | 10240 |
| 203 | Ga0466696_401056 | 3300042596 | Bacteria | 3260 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01649 | Ribosomal_S20p | Ribosomal protein S20 | 21 | 100 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.