Protein Family IF10089
Metagenome
Isolate
162
Members
50
Samples
154
Scaffolds
136.51
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_344618|Ga0466725_344618_730_1155
- Length
- 141 aa
- Sequence
- MEQMSTDRKYFHNELTDRVIRSFYSVYNELGFGFLENVYQNAMFFELKKNQSLKIEAQKAIPVYYQNQLVGNYKADLMVNDTVILELKAVDFLLEEHELQLINYLKATNIEIGLLLNFGKKPEIRRKIFTNDRKKIRENPV
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.0%
Unclassified
16.0%
Kalotermitidae
14.0%
Termopsidae
6.0%
Rhinotermitidae
4.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 2 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2820467504 | Unclassified Firmicutes Lab288P3bin1 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_003940 | 3300042601 | Bacteria | 6889 |
| 2 | Ga0466716_062076 | 3300042605 | Bacteria | 3216 |
| 3 | Ga0466722_194690 | 3300042609 | Bacteria | 1469 |
| 4 | Ga0466697_014191 | 3300042611 | Bacteria | 1353 |
| 5 | Ga0466697_022625 | 3300042611 | Bacteria | 2463 |
| 6 | Ga0123357_10492702 | 3300009784 | Bacteria | 1025 |
| 7 | Ga0123356_10545359 | 3300010049 | Archaea | 1320 |
| 8 | Ga0123356_11238391 | 3300010049 | Bacteria | 911 |
| 9 | Ga0123356_12427303 | 3300010049 | Bacteria | 656 |
| 10 | Ga0123356_13401732 | 3300010049 | Bacteria | 552 |
| 11 | Ga0123353_10217340 | 3300010167 | Bacteria | 2992 |
| 12 | Ga0123353_11956156 | 3300010167 | Bacteria | 720 |
| 13 | Ga0123353_12954462 | 3300010167 | Bacteria | 552 |
| 14 | Ga0466710_090402 | 3300042613 | Bacteria | 1375 |
| 15 | Ga0466710_130061 | 3300042613 | Bacteria | 7563 |
| 16 | Ga0466731_152421 | 3300042622 | Archaea | 1385 |
| 17 | Ga0466734_074671 | 3300042623 | Bacteria | 1313 |
| 18 | Ga0466727_080069 | 3300042655 | Bacteria | 1411 |
| 19 | Ga0466656_109935 | 3300042550 | Bacteria | 1020 |
| 20 | Ga0466694_282503 | 3300042594 | Bacteria | 1327 |
| 21 | Ga0466694_325220 | 3300042594 | Bacteria | 1875 |
| 22 | IMNBL1DRAFT_c0079873 | 3300000062 | Bacteria | 920 |
| 23 | JGI24698J34947_10113248 | 3300002449 | Bacteria | 1193 |
| 24 | JGI24696J40584_12602347 | 3300002834 | Bacteria | 658 |
| 25 | JGI24696J40584_12907651 | 3300002834 | Bacteria | 1230 |
| 26 | Ga0466701_079405 | 3300042598 | Bacteria | 3361 |
| 27 | Ga0466714_011537 | 3300042603 | Bacteria | 1746 |
| 28 | Ga0466717_296922 | 3300042604 | Bacteria | 1256 |
| 29 | Ga0123353_10171996 | 3300010167 | Bacteria | 3438 |
| 30 | Ga0123353_11712484 | 3300010167 | Bacteria | 787 |
| 31 | Ga0123353_11724618 | 3300010167 | Bacteria | 783 |
| 32 | Ga0123354_10174626 | 3300010882 | Bacteria | 2483 |
| 33 | Ga0466731_427205 | 3300042622 | Bacteria | 2311 |
| 34 | Ga0466693_264710 | 3300042592 | Bacteria | 5259 |
| 35 | Ga0466701_003203 | 3300042598 | Bacteria | 1009 |
| 36 | IMNBL1DRAFT_c0082338 | 3300000062 | Bacteria | 900 |
| 37 | IMNBL1DRAFT_c0149113 | 3300000062 | Bacteria | 601 |
| 38 | JGI24702J35022_10084901 | 3300002462 | Bacteria | 1719 |
| 39 | JGI24705J35276_12177462 | 3300002504 | Bacteria | 1339 |
| 40 | JGI24696J40584_12805531 | 3300002834 | Bacteria | 878 |
| 41 | Ga0466705_209672 | 3300042612 | Bacteria | 2226 |
| 42 | Ga0466733_062502 | 3300042659 | Bacteria | 1623 |
| 43 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 44 | Ga0466717_122004 | 3300042604 | Bacteria | 1164 |
| 45 | Ga0466721_048676 | 3300042608 | Bacteria | 1452 |
| 46 | Ga0466698_437412 | 3300042610 | Bacteria | 2320 |
| 47 | Ga0123356_10043587 | 3300010049 | Bacteria | 4178 |
| 48 | Ga0123356_10329965 | 3300010049 | Bacteria | 1642 |
| 49 | Ga0123356_13275893 | 3300010049 | Bacteria | 563 |
| 50 | Ga0123353_10095837 | 3300010167 | Bacteria | 4781 |
| 51 | Ga0123353_10245502 | 3300010167 | Bacteria | 2778 |
| 52 | Ga0123353_10300496 | 3300010167 | Bacteria | 2450 |
| 53 | Ga0123353_11779302 | 3300010167 | Bacteria | 767 |
| 54 | Ga0123354_10620260 | 3300010882 | Bacteria | 784 |
| 55 | Ga0123354_11007529 | 3300010882 | Bacteria | 535 |
| 56 | Ga0466705_499685 | 3300042612 | Bacteria | 7526 |
| 57 | Ga0466711_058509 | 3300042615 | Bacteria | 1503 |
| 58 | Ga0466735_158332 | 3300042624 | Bacteria | 1111 |
| 59 | Ga0466725_203838 | 3300042654 | Bacteria | 1169 |
| 60 | JGI24702J35022_10435709 | 3300002462 | Unclassified | 796 |
| 61 | JGI24702J35022_10479074 | 3300002462 | Bacteria | 761 |
| 62 | JGI24702J35022_10764625 | 3300002462 | Bacteria | 601 |
| 63 | JGI24705J35276_11754289 | 3300002504 | Bacteria | 659 |
| 64 | JGI24705J35276_12097009 | 3300002504 | Bacteria | 1009 |
| 65 | Ga0123357_10002055 | 3300009784 | Bacteria | 22079 |
| 66 | Ga0466701_102474 | 3300042598 | Bacteria | 27466 |
| 67 | Ga0466714_091380 | 3300042603 | Bacteria | 12690 |
| 68 | Ga0123357_10265326 | 3300009784 | Unclassified | 1806 |
| 69 | Ga0123357_10275280 | 3300009784 | Bacteria | 1750 |
| 70 | Ga0123353_11728279 | 3300010167 | Unclassified | 782 |
| 71 | Ga0466724_20990 | 3300042649 | Bacteria | 2753 |
| 72 | Ga0466656_252169 | 3300042550 | Bacteria | 1022 |
| 73 | Ga0466693_202541 | 3300042592 | Bacteria | 2224 |
| 74 | Ga0466694_345139 | 3300042594 | Bacteria | 3372 |
| 75 | Ga0466699_245613 | 3300042597 | Bacteria | 2295 |
| 76 | JGI24696J40584_12829878 | 3300002834 | Bacteria | 928 |
| 77 | Ga0466697_182982 | 3300042611 | Bacteria | 2724 |
| 78 | Ga0466701_059167 | 3300042598 | Bacteria | 1964 |
| 79 | Ga0466707_235090 | 3300042601 | Bacteria | 6865 |
| 80 | Ga0466714_048239 | 3300042603 | Bacteria | 109405 |
| 81 | Ga0123357_10008212 | 3300009784 | Bacteria | 13010 |
| 82 | Ga0123357_10139804 | 3300009784 | Unclassified | 2980 |
| 83 | Ga0123357_10554320 | 3300009784 | Bacteria | 914 |
| 84 | Ga0123356_12985709 | 3300010049 | Bacteria | 591 |
| 85 | Ga0123353_12268868 | 3300010167 | Bacteria | 654 |
| 86 | Ga0466731_244561 | 3300042622 | Bacteria | 3008 |
| 87 | Ga0466725_208783 | 3300042654 | Bacteria | 3889 |
| 88 | Ga0466725_344618 | 3300042654 | Bacteria | 1423 |
| 89 | Ga0466657_030952 | 3300042582 | Bacteria | 6550 |
| 90 | 2227199969 | 2225789004 | Bacteria | 1442 |
| 91 | IMNBL1DRAFT_c0012420 | 3300000062 | Bacteria | 3894 |
| 92 | JGI24695J34938_10288763 | 3300002450 | Bacteria | 706 |
| 93 | Ga0466701_044904 | 3300042598 | Bacteria | 1163 |
| 94 | Ga0466701_058442 | 3300042598 | Bacteria | 1363 |
| 95 | Ga0466701_078910 | 3300042598 | Bacteria | 2775 |
| 96 | Ga0466701_094231 | 3300042598 | Bacteria | 2334 |
| 97 | Ga0466700_173659 | 3300042600 | Bacteria | 1398 |
| 98 | Ga0466707_044626 | 3300042601 | Bacteria | 2593 |
| 99 | Ga0466721_283409 | 3300042608 | Bacteria | 1009 |
| 100 | Ga0123356_11496293 | 3300010049 | Bacteria | 833 |
| 101 | Ga0123353_10406123 | 3300010167 | Bacteria | 2025 |
| 102 | Ga0123353_10807568 | 3300010167 | Unclassified | 1294 |
| 103 | Ga0123353_11638362 | 3300010167 | Bacteria | 810 |
| 104 | Ga0123354_10430677 | 3300010882 | Bacteria | 1087 |
| 105 | Ga0466710_238750 | 3300042613 | Bacteria | 1464 |
| 106 | Ga0466711_269620 | 3300042615 | Bacteria | 10757 |
| 107 | Ga0466726_271153 | 3300042619 | Bacteria | 2924 |
| 108 | Ga0466703_165995 | 3300042636 | Bacteria | 1668 |
| 109 | Ga0466704_101081 | 3300042643 | Bacteria | 78712 |
| 110 | Ga0466725_121725 | 3300042654 | Bacteria | 27950 |
| 111 | Ga0466725_153319 | 3300042654 | Bacteria | 1260 |
| 112 | Ga0466690_095570 | 3300042590 | Bacteria | 1215 |
| 113 | Ga0466691_009200 | 3300042593 | Bacteria | 1067 |
| 114 | JGI24695J34938_10117208 | 3300002450 | Bacteria | 1084 |
| 115 | JGI24705J35276_12218468 | 3300002504 | Bacteria | 2146 |
| 116 | Ga0466701_073772 | 3300042598 | Bacteria | 5368 |
| 117 | Ga0466701_078636 | 3300042598 | Bacteria | 1377 |
| 118 | Ga0466706_187252 | 3300042599 | Bacteria | 1720 |
| 119 | Ga0466713_062748 | 3300042602 | Bacteria | 1825 |
| 120 | Ga0466714_162103 | 3300042603 | Bacteria | 35358 |
| 121 | Ga0123356_11474786 | 3300010049 | Bacteria | 839 |
| 122 | Ga0123353_11149158 | 3300010167 | Bacteria | 1025 |
| 123 | Ga0123354_10029433 | 3300010882 | Bacteria | 8640 |
| 124 | Ga0466711_089869 | 3300042615 | Bacteria | 12516 |
| 125 | Ga0466729_199454 | 3300042621 | Bacteria | 2274 |
| 126 | Ga0466734_037318 | 3300042623 | Bacteria | 4120 |
| 127 | Ga0466727_236154 | 3300042655 | Bacteria | 6767 |
| 128 | Ga0466657_105060 | 3300042582 | Bacteria | 11241 |
| 129 | IMNBL1DRAFT_c0041060 | 3300000062 | Bacteria | 1558 |
| 130 | JGI24705J35276_11863727 | 3300002504 | Bacteria | 724 |
| 131 | JGI24696J40584_12523026 | 3300002834 | Bacteria | 611 |
| 132 | JGI24696J40584_12954218 | 3300002834 | Bacteria | 2601 |
| 133 | JGI24696J40584_12960418 | 3300002834 | Bacteria | 7170 |
| 134 | Ga0466733_133956 | 3300042659 | Bacteria | 2443 |
| 135 | Ga0466701_016399 | 3300042598 | Bacteria | 21327 |
| 136 | Ga0466706_028321 | 3300042599 | Bacteria | 102705 |
| 137 | Ga0466707_219959 | 3300042601 | Bacteria | 2901 |
| 138 | Ga0466707_295989 | 3300042601 | Bacteria | 4112 |
| 139 | Ga0466707_354830 | 3300042601 | Bacteria | 18057 |
| 140 | Ga0466714_087620 | 3300042603 | Bacteria | 2919 |
| 141 | Ga0466721_270566 | 3300042608 | Bacteria | 2524 |
| 142 | Ga0123356_10010421 | 3300010049 | Bacteria | 9123 |
| 143 | Ga0123356_10463319 | 3300010049 | Bacteria | 1417 |
| 144 | Ga0123356_10671752 | 3300010049 | Bacteria | 1204 |
| 145 | Ga0123356_11354851 | 3300010049 | Bacteria | 873 |
| 146 | Ga0123356_13418300 | 3300010049 | Bacteria | 551 |
| 147 | Ga0123353_12628380 | 3300010167 | Bacteria | 595 |
| 148 | Ga0123354_10231167 | 3300010882 | Bacteria | 1932 |
| 149 | Ga0123354_10426705 | 3300010882 | Unclassified | 1096 |
| 150 | Ga0466726_474907 | 3300042619 | Bacteria | 8657 |
| 151 | Ga0466734_100095 | 3300042623 | Bacteria | 1488 |
| 152 | Ga0466727_098371 | 3300042655 | Bacteria | 10065 |
| 153 | JGI24705J35276_11858443 | 3300002504 | Bacteria | 721 |
| 154 | JGI24696J40584_12840877 | 3300002834 | Unclassified | 954 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13366 | PDDEXK_3 | PD-(D/E)XK nuclease superfamily | 14 | 126 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.