Protein Family IF10073
Metagenome
Isolate
199
Members
64
Samples
187
Scaffolds
106.3
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_255972|Ga0466725_255972_10828_11166
- Length
- 112 aa
- Sequence
- MSKLHIKKGDIVYVNTGEDRGKTGRVLKVLVEEQRAIVEGINMVTKHAKPSTKSPQGGREKQEASVHISNLNPLDPKSGKPTRVGRKLAAAGSKKKAEKYVRYAKKSGEELK
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Kalotermitidae
22.2%
Blattidae
15.9%
Termopsidae
6.3%
Unclassified
6.3%
Rhinotermitidae
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
193
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 16 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 17 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 27 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 28 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 51 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 52 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 56 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 57 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 58 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_375741 | 3300042612 | Bacteria | 24449 |
| 2 | Ga0466712_134727 | 3300042614 | Bacteria | 1454 |
| 3 | Ga0466711_137993 | 3300042615 | Bacteria | 2912 |
| 4 | Ga0466711_159176 | 3300042615 | Bacteria | 1748 |
| 5 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 6 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 7 | Ga0466719_504884 | 3300042606 | Bacteria | 4012 |
| 8 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 9 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 10 | Ga0466735_152196 | 3300042624 | Bacteria | 3972 |
| 11 | Ga0466704_300588 | 3300042643 | Bacteria | 28806 |
| 12 | IMNBL1DRAFT_c0111627 | 3300000062 | Bacteria | 725 |
| 13 | IMNBL1DRAFT_c0170624 | 3300000062 | Bacteria | 552 |
| 14 | JGI24702J35022_10000547 | 3300002462 | Bacteria | 22726 |
| 15 | JGI24696J40584_12946585 | 3300002834 | Bacteria | 1905 |
| 16 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 17 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 18 | Ga0466697_233826 | 3300042611 | Bacteria | 2096 |
| 19 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 20 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 21 | Ga0466733_132245 | 3300042659 | Bacteria | 2692 |
| 22 | Ga0466705_405321 | 3300042612 | Unclassified | 1477 |
| 23 | Ga0466715_016723 | 3300042616 | Bacteria | 13247 |
| 24 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 25 | Ga0466706_065455 | 3300042599 | Bacteria | 2096 |
| 26 | Ga0466706_264266 | 3300042599 | Bacteria | 6035 |
| 27 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 28 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 29 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 30 | Ga0466691_204814 | 3300042593 | Bacteria | 23707 |
| 31 | Ga0466696_323477 | 3300042596 | Bacteria | 3373 |
| 32 | Ga0466735_177951 | 3300042624 | Bacteria | 10162 |
| 33 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 34 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 35 | Ga0466704_552057 | 3300042643 | Bacteria | 6449 |
| 36 | Ga0466709_235305 | 3300042648 | Bacteria | 3321 |
| 37 | Ga0466727_029649 | 3300042655 | Bacteria | 1876 |
| 38 | 2227507944 | 2225789004 | Bacteria | 72999 |
| 39 | 2227667134 | 2225789004 | Bacteria | 1917 |
| 40 | IMNBL1DRAFT_c0002479 | 3300000062 | Bacteria | 12828 |
| 41 | JGI24696J40584_12659745 | 3300002834 | Unclassified | 701 |
| 42 | Ga0466705_089766 | 3300042612 | Bacteria | 11993 |
| 43 | Ga0466705_111418 | 3300042612 | Bacteria | 19183 |
| 44 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 45 | Ga0466732_257409 | 3300042656 | Bacteria | 6667 |
| 46 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 47 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 48 | Ga0466711_226259 | 3300042615 | Bacteria | 4193 |
| 49 | Ga0466715_025469 | 3300042616 | Bacteria | 20577 |
| 50 | Ga0466718_105474 | 3300042617 | Bacteria | 1253 |
| 51 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 52 | Ga0466728_396202 | 3300042620 | Bacteria | 2581 |
| 53 | Ga0466701_036012 | 3300042598 | Bacteria | 5947 |
| 54 | Ga0466713_002076 | 3300042602 | Bacteria | 1197 |
| 55 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 56 | Ga0466713_035081 | 3300042602 | Bacteria | 6541 |
| 57 | Ga0466720_147391 | 3300042607 | Bacteria | 1195 |
| 58 | Ga0466698_294665 | 3300042610 | Bacteria | 1732 |
| 59 | Ga0466690_176909 | 3300042590 | Unclassified | 2744 |
| 60 | Ga0466693_118156 | 3300042592 | Bacteria | 1058 |
| 61 | Ga0466691_066359 | 3300042593 | Bacteria | 26336 |
| 62 | Ga0123353_11673505 | 3300010167 | Bacteria | 799 |
| 63 | Ga0466731_324753 | 3300042622 | Bacteria | 1336 |
| 64 | Ga0466734_046575 | 3300042623 | Bacteria | 1614 |
| 65 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 66 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 67 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 68 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 69 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 70 | 2227160800 | 2225789004 | Bacteria | 1554 |
| 71 | IMNBL1DRAFT_c0007574 | 3300000062 | Bacteria | 5682 |
| 72 | IMNBL1DRAFT_c0012380 | 3300000062 | Bacteria | 3905 |
| 73 | JGI24698J34947_10009875 | 3300002449 | Bacteria | 5232 |
| 74 | Ga0068302_10164744 | 3300005071 | Bacteria | 1908 |
| 75 | Ga0466715_024383 | 3300042616 | Bacteria | 26866 |
| 76 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 77 | Ga0466726_293348 | 3300042619 | Bacteria | 4805 |
| 78 | Ga0466728_117468 | 3300042620 | Bacteria | 23405 |
| 79 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 80 | Ga0466707_310750 | 3300042601 | Unclassified | 2171 |
| 81 | Ga0466716_397647 | 3300042605 | Bacteria | 6519 |
| 82 | Ga0466719_025390 | 3300042606 | Bacteria | 13141 |
| 83 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 84 | Ga0466719_424805 | 3300042606 | Bacteria | 1163 |
| 85 | Ga0466656_294116 | 3300042550 | Bacteria | 2279 |
| 86 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 87 | Ga0466690_248799 | 3300042590 | Bacteria | 9265 |
| 88 | Ga0466695_284312 | 3300042595 | Bacteria | 2104 |
| 89 | Ga0466696_396970 | 3300042596 | Bacteria | 18436 |
| 90 | Ga0123356_10687077 | 3300010049 | Unclassified | 1192 |
| 91 | Ga0466735_035357 | 3300042624 | Bacteria | 1167 |
| 92 | Ga0466702_025284 | 3300042635 | Bacteria | 1089 |
| 93 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 94 | Ga0466704_004444 | 3300042643 | Bacteria | 24992 |
| 95 | Ga0466704_609706 | 3300042643 | Bacteria | 1171 |
| 96 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
| 97 | IMNBL1DRAFT_c0028980 | 3300000062 | Bacteria | 2055 |
| 98 | Ga0068302_10253966 | 3300005071 | Bacteria | 1523 |
| 99 | Ga0068305_10401000 | 3300005083 | Bacteria | 1125 |
| 100 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 101 | Ga0466710_347724 | 3300042613 | Bacteria | 2111 |
| 102 | Ga0466715_128269 | 3300042616 | Bacteria | 2365 |
| 103 | Ga0466723_040344 | 3300042618 | Bacteria | 37666 |
| 104 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 105 | Ga0466726_064923 | 3300042619 | Bacteria | 35500 |
| 106 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 107 | Ga0466726_146380 | 3300042619 | Bacteria | 1549 |
| 108 | Ga0466706_222694 | 3300042599 | Bacteria | 1811 |
| 109 | Ga0466719_064833 | 3300042606 | Bacteria | 2202 |
| 110 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 111 | Ga0466690_136616 | 3300042590 | Bacteria | 29160 |
| 112 | Ga0466696_145947 | 3300042596 | Unclassified | 1027 |
| 113 | Ga0466731_180586 | 3300042622 | Bacteria | 2122 |
| 114 | Ga0466735_032961 | 3300042624 | Bacteria | 1310 |
| 115 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 116 | Ga0466703_259701 | 3300042636 | Bacteria | 11196 |
| 117 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 118 | Ga0466709_083357 | 3300042648 | Bacteria | 39489 |
| 119 | Ga0466708_143755 | 3300042652 | Bacteria | 8647 |
| 120 | Ga0466727_289772 | 3300042655 | Bacteria | 14123 |
| 121 | 2227107214 | 2225789004 | Bacteria | 1761 |
| 122 | IMNBL1DRAFT_c0139215 | 3300000062 | Bacteria | 628 |
| 123 | JGI24702J35022_10008763 | 3300002462 | Bacteria | 5711 |
| 124 | JGI24705J35276_12186013 | 3300002504 | Bacteria | 1415 |
| 125 | Ga0466711_092510 | 3300042615 | Bacteria | 9915 |
| 126 | Ga0466711_212221 | 3300042615 | Bacteria | 10563 |
| 127 | Ga0466715_643493 | 3300042616 | Bacteria | 6621 |
| 128 | Ga0466723_257794 | 3300042618 | Bacteria | 2192 |
| 129 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 130 | Ga0466726_462884 | 3300042619 | Bacteria | 2272 |
| 131 | Ga0466728_346878 | 3300042620 | Bacteria | 2999 |
| 132 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 133 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 134 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 135 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 136 | Ga0123353_12321014 | 3300010167 | Bacteria | 644 |
| 137 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 138 | Ga0466708_135787 | 3300042652 | Bacteria | 29737 |
| 139 | 2227555189 | 2225789004 | Bacteria | 2799 |
| 140 | IMNBL1DRAFT_c0000082 | 3300000062 | Bacteria | 85768 |
| 141 | IMNBL1DRAFT_c0003005 | 3300000062 | Bacteria | 11178 |
| 142 | JGI24698J34947_10051090 | 3300002449 | Bacteria | 2081 |
| 143 | JGI24698J34947_10205859 | 3300002449 | Bacteria | 766 |
| 144 | Ga0068302_10271211 | 3300005071 | Bacteria | 888 |
| 145 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 146 | Ga0072941_1219958 | 3300005201 | Bacteria | 2247 |
| 147 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 148 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 149 | Ga0466711_007105 | 3300042615 | Bacteria | 19648 |
| 150 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 151 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 152 | Ga0466700_337138 | 3300042600 | Bacteria | 1239 |
| 153 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 154 | Ga0466719_102248 | 3300042606 | Bacteria | 3149 |
| 155 | Ga0466698_327264 | 3300042610 | Bacteria | 8551 |
| 156 | Ga0466696_053373 | 3300042596 | Bacteria | 10309 |
| 157 | Ga0466702_018603 | 3300042635 | Bacteria | 2106 |
| 158 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 159 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 160 | Ga0466709_223255 | 3300042648 | Bacteria | 9867 |
| 161 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 162 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 163 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 164 | Ga0068305_10002911 | 3300005083 | Bacteria | 2876 |
| 165 | Ga0466711_248472 | 3300042615 | Bacteria | 12038 |
| 166 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 167 | Ga0466726_494833 | 3300042619 | Bacteria | 4829 |
| 168 | Ga0466706_029356 | 3300042599 | Bacteria | 3415 |
| 169 | Ga0466706_183911 | 3300042599 | Bacteria | 19618 |
| 170 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 171 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 172 | Ga0466690_261027 | 3300042590 | Bacteria | 17850 |
| 173 | Ga0466690_306168 | 3300042590 | Bacteria | 1804 |
| 174 | Ga0466692_015583 | 3300042591 | Bacteria | 1005 |
| 175 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 176 | Ga0123356_10782185 | 3300010049 | Bacteria | 1125 |
| 177 | Ga0123353_10659237 | 3300010167 | Bacteria | 1479 |
| 178 | Ga0466735_082221 | 3300042624 | Bacteria | 1100 |
| 179 | Ga0466703_325817 | 3300042636 | Bacteria | 5487 |
| 180 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 181 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 182 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 183 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 184 | Ga0466727_212656 | 3300042655 | Bacteria | 11289 |
| 185 | 2227131383 | 2225789004 | Bacteria | 1658 |
| 186 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 187 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.