Protein Family IF10044
Metagenome
Isolate
145
Members
51
Samples
126
Scaffolds
87.86
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_085173|Ga0466725_085173_2133_2390
- Length
- 85 aa
- Sequence
- MTYKLDPSKVFKKSLKKLSDNEQRVLAGKLKILIENPFHPSLRTKKVQRLKDVFESSVNMDIRILWMFKGDMLILLINIGRHDIL
Sample Types
Isolate
13.1%
Metagenome
86.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.0%
Termitidae
34.0%
Kalotermitidae
16.0%
Termopsidae
4.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Rhinotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 2 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 3 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 4 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 5 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 12 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 23 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 27 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 28 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 32 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 33 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 34 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 35 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 45 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_149134 | 3300042659 | Bacteria | 2181 |
| 2 | Ga0466711_039579 | 3300042615 | Bacteria | 4542 |
| 3 | Ga0466657_215931 | 3300042582 | Bacteria | 1385 |
| 4 | Ga0123355_10000219 | 3300009826 | Bacteria | 72046 |
| 5 | Ga0123355_10106836 | 3300009826 | Bacteria | 4387 |
| 6 | Ga0123355_10177716 | 3300009826 | Unclassified | 3166 |
| 7 | Ga0123355_10240867 | 3300009826 | Bacteria | 2563 |
| 8 | Ga0123355_10957500 | 3300009826 | Bacteria | 918 |
| 9 | Ga0123355_11137002 | 3300009826 | Bacteria | 807 |
| 10 | Ga0466706_090017 | 3300042599 | Bacteria | 1023 |
| 11 | Ga0466720_010155 | 3300042607 | Bacteria | 3559 |
| 12 | Ga0466721_133267 | 3300042608 | Bacteria | 1149 |
| 13 | 2227489308 | 2225789004 | Bacteria | 799 |
| 14 | JGI24695J34938_10141318 | 3300002450 | Bacteria | 984 |
| 15 | Ga0072941_1251116 | 3300005201 | Unclassified | 1637 |
| 16 | Ga0466703_334331 | 3300042636 | Bacteria | 1652 |
| 17 | Ga0466725_085173 | 3300042654 | Bacteria | 5662 |
| 18 | Ga0466733_218588 | 3300042659 | Bacteria | 25734 |
| 19 | Ga0466726_366488 | 3300042619 | Bacteria | 1476 |
| 20 | Ga0415639_063935 | 3300038395 | Bacteria | 6683 |
| 21 | Ga0123356_10039202 | 3300010049 | Bacteria | 4414 |
| 22 | Ga0123356_11173154 | 3300010049 | Bacteria | 935 |
| 23 | Ga0123356_11791595 | 3300010049 | Bacteria | 763 |
| 24 | Ga0123353_10180910 | 3300010167 | Bacteria | 3338 |
| 25 | Ga0123353_10241406 | 3300010167 | Bacteria | 2807 |
| 26 | Ga0123353_10823024 | 3300010167 | Archaea | 1278 |
| 27 | Ga0123353_10957500 | 3300010167 | Bacteria | 1157 |
| 28 | Ga0123353_12552104 | 3300010167 | Bacteria | 606 |
| 29 | Ga0123353_12933951 | 3300010167 | Bacteria | 554 |
| 30 | Ga0466707_211813 | 3300042601 | Bacteria | 44342 |
| 31 | Ga0466714_011568 | 3300042603 | Bacteria | 1600 |
| 32 | JGI24703J35330_11208602 | 3300002501 | Bacteria | 768 |
| 33 | Ga0466705_034159 | 3300042612 | Bacteria | 19681 |
| 34 | Ga0466733_066445 | 3300042659 | Bacteria | 1034 |
| 35 | Ga0466715_386200 | 3300042616 | Bacteria | 3358 |
| 36 | Ga0415639_002577 | 3300038395 | Bacteria | 3229 |
| 37 | Ga0123355_10002207 | 3300009826 | Bacteria | 27487 |
| 38 | Ga0123355_10318017 | 3300009826 | Bacteria | 2101 |
| 39 | Ga0123355_10712207 | 3300009826 | Bacteria | 1148 |
| 40 | Ga0123355_10800202 | 3300009826 | Bacteria | 1051 |
| 41 | Ga0123356_10127259 | 3300010049 | Bacteria | 2489 |
| 42 | Ga0123356_10263926 | 3300010049 | Bacteria | 1807 |
| 43 | Ga0123356_11929953 | 3300010049 | Bacteria | 736 |
| 44 | Ga0123356_12946200 | 3300010049 | Bacteria | 595 |
| 45 | Ga0123353_10188744 | 3300010167 | Bacteria | 3256 |
| 46 | Ga0123353_10189513 | 3300010167 | Bacteria | 3248 |
| 47 | Ga0123353_10444926 | 3300010167 | Archaea | 1910 |
| 48 | Ga0123353_11113310 | 3300010167 | Bacteria | 1047 |
| 49 | Ga0123353_11156992 | 3300010167 | Bacteria | 1020 |
| 50 | Ga0466714_018970 | 3300042603 | Bacteria | 1801 |
| 51 | Ga0466722_023018 | 3300042609 | Bacteria | 1292 |
| 52 | 2227122488 | 2225789004 | Unclassified | 9117 |
| 53 | IMNBL1DRAFT_c0001941 | 3300000062 | Bacteria | 14909 |
| 54 | IMNBL1DRAFT_c0002996 | 3300000062 | Bacteria | 11197 |
| 55 | JGI24695J34938_10007767 | 3300002450 | Bacteria | 6215 |
| 56 | JGI24703J35330_11730075 | 3300002501 | Bacteria | 2688 |
| 57 | JGI24703J35330_11748678 | 3300002501 | Bacteria | 24641 |
| 58 | Ga0466704_353291 | 3300042643 | Bacteria | 1493 |
| 59 | Ga0466726_167307 | 3300042619 | Unclassified | 2954 |
| 60 | Ga0415639_007582 | 3300038395 | Bacteria | 3061 |
| 61 | Ga0415639_051508 | 3300038395 | Bacteria | 2068 |
| 62 | Ga0415639_081941 | 3300038395 | Bacteria | 2023 |
| 63 | Ga0415639_132085 | 3300038395 | Bacteria | 1165 |
| 64 | Ga0466693_412795 | 3300042592 | Bacteria | 1381 |
| 65 | Ga0466694_358405 | 3300042594 | Bacteria | 4073 |
| 66 | Ga0123355_10167124 | 3300009826 | Bacteria | 3298 |
| 67 | Ga0123355_11145590 | 3300009826 | Bacteria | 802 |
| 68 | Ga0123355_11364804 | 3300009826 | Unclassified | 704 |
| 69 | Ga0123353_10690919 | 3300010167 | Bacteria | 1435 |
| 70 | Ga0123353_10977244 | 3300010167 | Bacteria | 1141 |
| 71 | Ga0466706_140584 | 3300042599 | Bacteria | 7133 |
| 72 | IMNBL1DRAFT_c0001839 | 3300000062 | Bacteria | 15464 |
| 73 | JGI24702J35022_10187591 | 3300002462 | Bacteria | 1178 |
| 74 | Ga0068302_10128217 | 3300005071 | Bacteria | 1894 |
| 75 | Ga0466696_277961 | 3300042596 | Bacteria | 1729 |
| 76 | Ga0123355_10069622 | 3300009826 | Bacteria | 5655 |
| 77 | Ga0123355_10754611 | 3300009826 | Bacteria | 1099 |
| 78 | Ga0123355_10798082 | 3300009826 | Unclassified | 1053 |
| 79 | Ga0123356_10286305 | 3300010049 | Bacteria | 1746 |
| 80 | Ga0123356_11168507 | 3300010049 | Bacteria | 936 |
| 81 | Ga0123356_13619065 | 3300010049 | Bacteria | 535 |
| 82 | Ga0123353_10409531 | 3300010167 | Bacteria | 2014 |
| 83 | Ga0123354_10737617 | 3300010882 | Bacteria | 678 |
| 84 | JGI24695J34938_10112760 | 3300002450 | Bacteria | 1107 |
| 85 | JGI24695J34938_10257273 | 3300002450 | Bacteria | 743 |
| 86 | JGI24703J35330_11153108 | 3300002501 | Bacteria | 727 |
| 87 | Ga0466709_053058 | 3300042648 | Bacteria | 4332 |
| 88 | Ga0123355_10000752 | 3300009826 | Bacteria | 44274 |
| 89 | Ga0123355_10004935 | 3300009826 | Bacteria | 19422 |
| 90 | Ga0123355_10239757 | 3300009826 | Bacteria | 2571 |
| 91 | Ga0123355_11391231 | 3300009826 | Bacteria | 694 |
| 92 | Ga0123355_11874527 | 3300009826 | Bacteria | 562 |
| 93 | Ga0123356_10100792 | 3300010049 | Bacteria | 2770 |
| 94 | Ga0123356_11314641 | 3300010049 | Bacteria | 886 |
| 95 | Ga0123356_11750086 | 3300010049 | Unclassified | 772 |
| 96 | Ga0466706_075905 | 3300042599 | Bacteria | 19317 |
| 97 | Ga0466714_023033 | 3300042603 | Bacteria | 1196 |
| 98 | Ga0466719_523382 | 3300042606 | Bacteria | 2547 |
| 99 | IMNBL1DRAFT_c0198864 | 3300000062 | Bacteria | 503 |
| 100 | Ga0068302_10420409 | 3300005071 | Bacteria | 1065 |
| 101 | Ga0466703_426523 | 3300042636 | Bacteria | 1105 |
| 102 | Ga0466711_184399 | 3300042615 | Bacteria | 1537 |
| 103 | Ga0123355_10018169 | 3300009826 | Bacteria | 11139 |
| 104 | Ga0123355_10142518 | 3300009826 | Bacteria | 3663 |
| 105 | Ga0123355_10585806 | 3300009826 | Bacteria | 1331 |
| 106 | Ga0123355_11045624 | 3300009826 | Bacteria | 859 |
| 107 | Ga0123355_11751306 | 3300009826 | Bacteria | 589 |
| 108 | Ga0123353_10031405 | 3300010167 | Bacteria | 8227 |
| 109 | Ga0123353_10196894 | 3300010167 | Bacteria | 3175 |
| 110 | Ga0123353_10272852 | 3300010167 | Bacteria | 2604 |
| 111 | IMNBL1DRAFT_c0043528 | 3300000062 | Bacteria | 1485 |
| 112 | JGI24703J35330_11417847 | 3300002501 | Bacteria | 984 |
| 113 | Ga0466704_158679 | 3300042643 | Bacteria | 72849 |
| 114 | Ga0415639_018683 | 3300038395 | Bacteria | 6670 |
| 115 | Ga0415639_076045 | 3300038395 | Bacteria | 1232 |
| 116 | Ga0123355_10003831 | 3300009826 | Bacteria | 21756 |
| 117 | Ga0123355_11360489 | 3300009826 | Bacteria | 706 |
| 118 | Ga0123355_11418819 | 3300009826 | Bacteria | 685 |
| 119 | Ga0123356_10435787 | 3300010049 | Bacteria | 1456 |
| 120 | Ga0123354_10431205 | 3300010882 | Bacteria | 1085 |
| 121 | Ga0466706_152416 | 3300042599 | Bacteria | 86486 |
| 122 | Ga0466714_040471 | 3300042603 | Bacteria | 1131 |
| 123 | JGI24695J34938_10001202 | 3300002450 | Bacteria | 22948 |
| 124 | JGI24702J35022_10000883 | 3300002462 | Bacteria | 18580 |
| 125 | JGI24703J35330_11747769 | 3300002501 | Bacteria | 8161 |
| 126 | Ga0466734_063322 | 3300042623 | Bacteria | 1020 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.