Protein Family IF10031
Metagenome
Isolate
259
Members
75
Samples
229
Scaffolds
357.51
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_018548|Ga0466725_018548_447_1601
- Length
- 384 aa
- Sequence
- LITADTSLSFTNQRLGIQKKREIDMGKKTIIPFGPQHPVLPEPIHLDLVVEDEIVVDAIPSIGYVHRGLEKLVEQKDYIDMVYVIERVCGICSFGHGWGYCSAVEGLMNIEVPRRAEYLRTVWQELSRIHSHLMWLGLYADGFGFESLFMHCWRLRETILEIFEKTTGGRVIFSVCKVGGIRHDIDNETLRDMVLTLENIREELKELTNVFITDKSVENRTRGVGTLKKEDAVKHGAVGPVARGSGVMQDMRLIGYGAYNDLTFEPIIETAGDCHARACVRIRELFQSMDLIREAVSKIPGGDIAVPVKGDVPVGDFVMRIEQPRGEAYYYAKGAGSKFLKRMRVRTPTNQNIPALVNLLQGCELADVPTLVLTIDPCISCTER
Sample Types
Isolate
11.2%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.0%
Unclassified
33.3%
Kalotermitidae
17.3%
Rhinotermitidae
5.3%
Termopsidae
4.0%
Passalidae
2.7%
Hodotermitidae
1.3%
Taxonomy
Archaea
7
Bacteria
214
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 3 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 4 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 5 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 8 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 9 | 2820403592 | Unclassified Firmicutes Lab288P4bin93 | Isolate | Unclassified |
| 10 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 19 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 29 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 30 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 31 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 32 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 33 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 44 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 45 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 50 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 56 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 57 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 58 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 59 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 60 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 63 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 64 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 65 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 69 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 70 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 71 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 72 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 73 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 75 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_203524 | 3300042611 | Bacteria | 1938 |
| 2 | Ga0466705_010323 | 3300042612 | Bacteria | 8691 |
| 3 | Ga0466733_138023 | 3300042659 | Bacteria | 6446 |
| 4 | JGI24702J35022_10060185 | 3300002462 | Unclassified | 2030 |
| 5 | Ga0123356_10225132 | 3300010049 | Unclassified | 1935 |
| 6 | Ga0123353_10000350 | 3300010167 | Bacteria | 56344 |
| 7 | Ga0123353_10000755 | 3300010167 | Bacteria | 39222 |
| 8 | Ga0123353_10043908 | 3300010167 | Bacteria | 7083 |
| 9 | Ga0123353_10258160 | 3300010167 | Bacteria | 2694 |
| 10 | Ga0123353_10470155 | 3300010167 | Bacteria | 1844 |
| 11 | Ga0123354_10040646 | 3300010882 | Unclassified | 7194 |
| 12 | Ga0415639_008504 | 3300038395 | Unclassified | 4198 |
| 13 | Ga0415639_249514 | 3300038395 | Bacteria | 2273 |
| 14 | Ga0466657_232883 | 3300042582 | Bacteria | 4235 |
| 15 | Ga0466694_121032 | 3300042594 | Bacteria | 3749 |
| 16 | Ga0466694_236568 | 3300042594 | Bacteria | 2200 |
| 17 | Ga0466696_021126 | 3300042596 | Bacteria | 12251 |
| 18 | Ga0466706_110782 | 3300042599 | Bacteria | 2601 |
| 19 | Ga0466706_201446 | 3300042599 | Bacteria | 12397 |
| 20 | Ga0466717_257229 | 3300042604 | Bacteria | 10074 |
| 21 | Ga0466722_056191 | 3300042609 | Bacteria | 34618 |
| 22 | Ga0466722_229173 | 3300042609 | Bacteria | 12380 |
| 23 | Ga0466697_044686 | 3300042611 | Bacteria | 2682 |
| 24 | Ga0466711_082747 | 3300042615 | Bacteria | 2513 |
| 25 | Ga0466711_376750 | 3300042615 | Bacteria | 10002 |
| 26 | Ga0466715_196706 | 3300042616 | Bacteria | 8941 |
| 27 | Ga0466723_102233 | 3300042618 | Bacteria | 5233 |
| 28 | Ga0466729_218189 | 3300042621 | Bacteria | 10828 |
| 29 | Ga0466703_330436 | 3300042636 | Bacteria | 3058 |
| 30 | Ga0466708_350299 | 3300042652 | Unclassified | 11766 |
| 31 | Ga0466727_046520 | 3300042655 | Unclassified | 9724 |
| 32 | Ga0466705_080272 | 3300042612 | Bacteria | 96661 |
| 33 | Ga0466705_126394 | 3300042612 | Bacteria | 14291 |
| 34 | 2227264131 | 2225789004 | Bacteria | 6974 |
| 35 | IMNBL1DRAFT_c0015829 | 3300000062 | Bacteria | 3253 |
| 36 | Ga0123357_10001802 | 3300009784 | Unclassified | 23196 |
| 37 | Ga0123357_10400496 | 3300009784 | Bacteria | 1249 |
| 38 | Ga0123356_10015580 | 3300010049 | Bacteria | 7281 |
| 39 | Ga0123353_10150862 | 3300010167 | Bacteria | 3711 |
| 40 | Ga0123353_10816007 | 3300010167 | Bacteria | 1285 |
| 41 | Ga0466692_036445 | 3300042591 | Bacteria | 12692 |
| 42 | Ga0466692_145444 | 3300042591 | Bacteria | 8880 |
| 43 | Ga0466695_386742 | 3300042595 | Bacteria | 1260 |
| 44 | Ga0466696_116226 | 3300042596 | Bacteria | 2791 |
| 45 | Ga0466696_345899 | 3300042596 | Bacteria | 3589 |
| 46 | Ga0466706_220490 | 3300042599 | Bacteria | 222739 |
| 47 | Ga0466706_270788 | 3300042599 | Unclassified | 8882 |
| 48 | Ga0466707_037768 | 3300042601 | Bacteria | 19093 |
| 49 | Ga0466716_212663 | 3300042605 | Bacteria | 18159 |
| 50 | Ga0466719_059395 | 3300042606 | Bacteria | 2586 |
| 51 | Ga0466723_307525 | 3300042618 | Bacteria | 2228 |
| 52 | Ga0466726_170361 | 3300042619 | Bacteria | 1780 |
| 53 | Ga0466729_240825 | 3300042621 | Bacteria | 150412 |
| 54 | Ga0466734_094167 | 3300042623 | Bacteria | 3781 |
| 55 | Ga0466703_208799 | 3300042636 | Bacteria | 7879 |
| 56 | Ga0466704_604329 | 3300042643 | Bacteria | 42688 |
| 57 | Ga0466708_094676 | 3300042652 | Bacteria | 157715 |
| 58 | Ga0466708_301014 | 3300042652 | Bacteria | 3058 |
| 59 | Ga0466725_018548 | 3300042654 | Bacteria | 1645 |
| 60 | JGI24702J35022_10003689 | 3300002462 | Bacteria | 9212 |
| 61 | Ga0123357_10000617 | 3300009784 | Bacteria | 35279 |
| 62 | Ga0123357_10003865 | 3300009784 | Bacteria | 17371 |
| 63 | Ga0123357_10278208 | 3300009784 | Bacteria | 1734 |
| 64 | Ga0123356_10004807 | 3300010049 | Archaea | 13895 |
| 65 | Ga0123353_10067182 | 3300010167 | Bacteria | 5757 |
| 66 | Ga0123353_10201350 | 3300010167 | Bacteria | 3132 |
| 67 | Ga0123353_10234819 | 3300010167 | Unclassified | 2855 |
| 68 | Ga0123353_10319155 | 3300010167 | Bacteria | 2359 |
| 69 | Ga0123354_10197777 | 3300010882 | Bacteria | 2223 |
| 70 | Ga0415639_190431 | 3300038395 | Bacteria | 1484 |
| 71 | Ga0466701_089564 | 3300042598 | Bacteria | 4818 |
| 72 | Ga0466719_555421 | 3300042606 | Bacteria | 2167 |
| 73 | Ga0466722_016863 | 3300042609 | Bacteria | 3598 |
| 74 | Ga0466711_103935 | 3300042615 | Bacteria | 25381 |
| 75 | Ga0466715_279250 | 3300042616 | Unclassified | 2481 |
| 76 | Ga0466715_430374 | 3300042616 | Bacteria | 2475 |
| 77 | Ga0466728_052641 | 3300042620 | Bacteria | 3918 |
| 78 | Ga0466729_015967 | 3300042621 | Bacteria | 5412 |
| 79 | Ga0466702_355132 | 3300042635 | Bacteria | 1220 |
| 80 | Ga0466703_293018 | 3300042636 | Unclassified | 25371 |
| 81 | Ga0466708_150579 | 3300042652 | Bacteria | 10670 |
| 82 | Ga0466705_070960 | 3300042612 | Bacteria | 14563 |
| 83 | Ga0466705_364445 | 3300042612 | Bacteria | 7130 |
| 84 | IMNBL1DRAFT_c0035270 | 3300000062 | Bacteria | 1766 |
| 85 | JGI24705J35276_12236869 | 3300002504 | Bacteria | 9132 |
| 86 | JGI24705J35276_12237436 | 3300002504 | Bacteria | 11139 |
| 87 | Ga0123357_10000393 | 3300009784 | Bacteria | 41534 |
| 88 | Ga0123357_10182994 | 3300009784 | Bacteria | 2440 |
| 89 | Ga0123353_10022125 | 3300010167 | Unclassified | 9569 |
| 90 | Ga0123353_10484442 | 3300010167 | Bacteria | 1809 |
| 91 | Ga0123353_10758673 | 3300010167 | Bacteria | 1349 |
| 92 | Ga0123354_10023028 | 3300010882 | Bacteria | 9822 |
| 93 | Ga0123354_10082309 | 3300010882 | Bacteria | 4538 |
| 94 | Ga0466692_128204 | 3300042591 | Bacteria | 13294 |
| 95 | Ga0466706_100428 | 3300042599 | Bacteria | 11035 |
| 96 | Ga0466713_034076 | 3300042602 | Bacteria | 7713 |
| 97 | Ga0466713_119043 | 3300042602 | Bacteria | 91363 |
| 98 | Ga0466705_444615 | 3300042612 | Unclassified | 2025 |
| 99 | Ga0466711_304892 | 3300042615 | Bacteria | 4021 |
| 100 | Ga0466715_035009 | 3300042616 | Bacteria | 15330 |
| 101 | Ga0466703_309486 | 3300042636 | Bacteria | 5661 |
| 102 | Ga0466705_166227 | 3300042612 | Unclassified | 1984 |
| 103 | Ga0466705_310655 | 3300042612 | Unclassified | 4686 |
| 104 | Ga0123357_10006331 | 3300009784 | Unclassified | 14417 |
| 105 | Ga0123357_10126510 | 3300009784 | Archaea | 3199 |
| 106 | Ga0123356_10015375 | 3300010049 | Bacteria | 7340 |
| 107 | Ga0123356_10416391 | 3300010049 | Bacteria | 1485 |
| 108 | Ga0123353_10003825 | 3300010167 | Bacteria | 19199 |
| 109 | Ga0123353_10138717 | 3300010167 | Unclassified | 3898 |
| 110 | Ga0123353_10147769 | 3300010167 | Unclassified | 3756 |
| 111 | Ga0415639_022672 | 3300038395 | Bacteria | 2523 |
| 112 | Ga0415639_060770 | 3300038395 | Bacteria | 3447 |
| 113 | Ga0466692_062288 | 3300042591 | Bacteria | 6982 |
| 114 | Ga0466693_259600 | 3300042592 | Bacteria | 3362 |
| 115 | Ga0466691_027701 | 3300042593 | Unclassified | 2455 |
| 116 | Ga0466696_376777 | 3300042596 | Bacteria | 7292 |
| 117 | Ga0466706_054381 | 3300042599 | Bacteria | 28961 |
| 118 | Ga0466700_126309 | 3300042600 | Bacteria | 3187 |
| 119 | Ga0466707_290265 | 3300042601 | Bacteria | 80468 |
| 120 | Ga0466707_375658 | 3300042601 | Bacteria | 2610 |
| 121 | Ga0466713_047198 | 3300042602 | Bacteria | 37804 |
| 122 | Ga0466713_084534 | 3300042602 | Bacteria | 40687 |
| 123 | Ga0466713_120837 | 3300042602 | Bacteria | 34171 |
| 124 | Ga0466719_015066 | 3300042606 | Bacteria | 3197 |
| 125 | Ga0466722_022903 | 3300042609 | Bacteria | 59354 |
| 126 | Ga0466722_123864 | 3300042609 | Bacteria | 6255 |
| 127 | Ga0466710_171993 | 3300042613 | Bacteria | 1843 |
| 128 | Ga0466715_636966 | 3300042616 | Bacteria | 23671 |
| 129 | Ga0466718_156364 | 3300042617 | Bacteria | 2212 |
| 130 | Ga0466726_064325 | 3300042619 | Bacteria | 7327 |
| 131 | Ga0466728_447585 | 3300042620 | Bacteria | 7012 |
| 132 | Ga0466729_157478 | 3300042621 | Archaea | 18890 |
| 133 | Ga0466729_255774 | 3300042621 | Bacteria | 2863 |
| 134 | Ga0466731_174355 | 3300042622 | Bacteria | 2110 |
| 135 | Ga0466704_220698 | 3300042643 | Bacteria | 20461 |
| 136 | Ga0466704_539327 | 3300042643 | Unclassified | 2070 |
| 137 | Ga0466705_224726 | 3300042612 | Bacteria | 1351 |
| 138 | Ga0466733_028952 | 3300042659 | Bacteria | 6766 |
| 139 | 2227164133 | 2225789004 | Archaea | 35411 |
| 140 | Ga0123357_10066901 | 3300009784 | Bacteria | 4790 |
| 141 | Ga0123357_10162982 | 3300009784 | Unclassified | 2666 |
| 142 | Ga0123355_10002282 | 3300009826 | Bacteria | 27105 |
| 143 | Ga0123353_10118368 | 3300010167 | Bacteria | 4260 |
| 144 | Ga0123353_10260470 | 3300010167 | Bacteria | 2679 |
| 145 | Ga0123353_10498288 | 3300010167 | Bacteria | 1776 |
| 146 | Ga0123353_10636817 | 3300010167 | Unclassified | 1513 |
| 147 | Ga0123353_10807054 | 3300010167 | Bacteria | 1294 |
| 148 | Ga0123354_10005611 | 3300010882 | Bacteria | 18303 |
| 149 | Ga0123354_10335407 | 3300010882 | Bacteria | 1372 |
| 150 | Ga0466692_037540 | 3300042591 | Bacteria | 13895 |
| 151 | Ga0466696_426789 | 3300042596 | Bacteria | 3088 |
| 152 | Ga0466706_009640 | 3300042599 | Unclassified | 1576 |
| 153 | Ga0466706_225407 | 3300042599 | Unclassified | 9330 |
| 154 | Ga0466707_200922 | 3300042601 | Bacteria | 1220 |
| 155 | Ga0466713_134960 | 3300042602 | Bacteria | 119382 |
| 156 | Ga0466717_030757 | 3300042604 | Bacteria | 1421 |
| 157 | Ga0466719_036872 | 3300042606 | Bacteria | 11941 |
| 158 | Ga0466719_222722 | 3300042606 | Bacteria | 1350 |
| 159 | Ga0466711_040445 | 3300042615 | Bacteria | 3939 |
| 160 | Ga0466715_032202 | 3300042616 | Bacteria | 10732 |
| 161 | Ga0466715_167943 | 3300042616 | Unclassified | 7074 |
| 162 | Ga0466715_346150 | 3300042616 | Bacteria | 6208 |
| 163 | Ga0466718_035259 | 3300042617 | Archaea | 1808 |
| 164 | Ga0466726_050082 | 3300042619 | Bacteria | 10916 |
| 165 | Ga0466735_100731 | 3300042624 | Bacteria | 3601 |
| 166 | Ga0466735_179243 | 3300042624 | Bacteria | 51950 |
| 167 | Ga0466703_142784 | 3300042636 | Archaea | 52677 |
| 168 | Ga0466704_108889 | 3300042643 | Bacteria | 5504 |
| 169 | Ga0466704_580976 | 3300042643 | Bacteria | 27180 |
| 170 | Ga0466709_359671 | 3300042648 | Unclassified | 25056 |
| 171 | Ga0466708_008008 | 3300042652 | Bacteria | 12782 |
| 172 | Ga0466708_125153 | 3300042652 | Bacteria | 3921 |
| 173 | Ga0466705_228545 | 3300042612 | Bacteria | 10396 |
| 174 | Ga0123357_10387266 | 3300009784 | Bacteria | 1289 |
| 175 | Ga0123356_10151747 | 3300010049 | Bacteria | 2301 |
| 176 | Ga0123353_10198081 | 3300010167 | Bacteria | 3163 |
| 177 | Ga0123353_10441919 | 3300010167 | Unclassified | 1918 |
| 178 | Ga0123354_10031535 | 3300010882 | Bacteria | 8312 |
| 179 | Ga0123354_10052759 | 3300010882 | Bacteria | 6122 |
| 180 | Ga0466700_308095 | 3300042600 | Bacteria | 5305 |
| 181 | Ga0466707_357636 | 3300042601 | Bacteria | 1369 |
| 182 | Ga0466713_042087 | 3300042602 | Bacteria | 3512 |
| 183 | Ga0466713_068412 | 3300042602 | Bacteria | 23498 |
| 184 | Ga0466717_184929 | 3300042604 | Unclassified | 1873 |
| 185 | Ga0466716_018346 | 3300042605 | Bacteria | 2753 |
| 186 | Ga0466716_353809 | 3300042605 | Bacteria | 12526 |
| 187 | Ga0466705_424012 | 3300042612 | Unclassified | 1307 |
| 188 | Ga0466705_425873 | 3300042612 | Bacteria | 39314 |
| 189 | Ga0466711_028059 | 3300042615 | Bacteria | 1504 |
| 190 | Ga0466715_259620 | 3300042616 | Bacteria | 7511 |
| 191 | Ga0466723_103850 | 3300042618 | Bacteria | 25266 |
| 192 | Ga0466731_214692 | 3300042622 | Unclassified | 1531 |
| 193 | Ga0466703_343547 | 3300042636 | Bacteria | 6542 |
| 194 | Ga0466704_488168 | 3300042643 | Unclassified | 3023 |
| 195 | Ga0466704_610505 | 3300042643 | Unclassified | 3314 |
| 196 | Ga0466709_011774 | 3300042648 | Unclassified | 21339 |
| 197 | Ga0466709_204826 | 3300042648 | Bacteria | 5244 |
| 198 | Ga0466708_402143 | 3300042652 | Bacteria | 39815 |
| 199 | Ga0466727_147798 | 3300042655 | Bacteria | 20785 |
| 200 | Ga0466727_259059 | 3300042655 | Bacteria | 3846 |
| 201 | Ga0466705_308662 | 3300042612 | Bacteria | 2027 |
| 202 | Ga0466705_374187 | 3300042612 | Bacteria | 2330 |
| 203 | 2227125258 | 2225789004 | Archaea | 9068 |
| 204 | 2227502401 | 2225789004 | Bacteria | 19242 |
| 205 | IMNBL1DRAFT_c0004432 | 3300000062 | Bacteria | 8454 |
| 206 | JGI24702J35022_10034331 | 3300002462 | Bacteria | 2713 |
| 207 | Ga0123357_10060571 | 3300009784 | Bacteria | 5077 |
| 208 | Ga0123356_10010210 | 3300010049 | Bacteria | 9235 |
| 209 | Ga0123356_10315640 | 3300010049 | Bacteria | 1674 |
| 210 | Ga0123353_10008297 | 3300010167 | Bacteria | 14168 |
| 211 | Ga0123353_10021233 | 3300010167 | Bacteria | 9738 |
| 212 | Ga0123353_10026125 | 3300010167 | Bacteria | 8911 |
| 213 | Ga0123353_10254968 | 3300010167 | Bacteria | 2714 |
| 214 | Ga0123354_10243063 | 3300010882 | Unclassified | 1846 |
| 215 | Ga0466696_315311 | 3300042596 | Bacteria | 3095 |
| 216 | Ga0466706_063164 | 3300042599 | Unclassified | 26711 |
| 217 | Ga0466706_243073 | 3300042599 | Bacteria | 9636 |
| 218 | Ga0466707_007536 | 3300042601 | Bacteria | 1233 |
| 219 | Ga0466707_182542 | 3300042601 | Unclassified | 5074 |
| 220 | Ga0466707_327812 | 3300042601 | Bacteria | 8266 |
| 221 | Ga0466716_133330 | 3300042605 | Bacteria | 1246 |
| 222 | Ga0466698_272673 | 3300042610 | Unclassified | 2945 |
| 223 | Ga0466705_400565 | 3300042612 | Unclassified | 3936 |
| 224 | Ga0466710_240469 | 3300042613 | Bacteria | 5355 |
| 225 | Ga0466726_018500 | 3300042619 | Bacteria | 14232 |
| 226 | Ga0466729_101988 | 3300042621 | Bacteria | 1622 |
| 227 | Ga0466729_226152 | 3300042621 | Bacteria | 57974 |
| 228 | Ga0466704_079784 | 3300042643 | Bacteria | 8823 |
| 229 | Ga0466727_189189 | 3300042655 | Bacteria | 3213 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00374 | GO:0016151 | nickel cation binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.