Protein Family IF10006
Metagenome
Isolate
158
Members
55
Samples
143
Scaffolds
535.41
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_394234|Ga0466708_394234_1363_3066
- Length
- 567 aa
- Sequence
- MEFVRKPGFPDRSNKEPNMRLNDRELENRAQWEKAGIELPKFDRGAMIRATRAAPEWVHFGAGNIFRIFPAGLQQNLIEAGIEKTGIVMVAGRDGGILDQVFKPCDNLTLGVTLRANGEIRKRIIASIADSYWMGAAGDYGALKNIFRAPSLKMASFTITEKGYNIKDGGGEYLADAAADFAAGPGGATGPGNYMGKIAALAWERYLAGRAAGKTLPLAFVSMDNCSHNGDRLFSSVEAFALAWAERGLVEKGFVDYLRDRNAVSFPWSMIDKITPGPDRGVREMLEKDGFTDTEFYAKTTPTAPFVNAEEPQYLVVEDAFPAGRPALDRAGALFTRREIVDKVEKMKVCTCLNPLHTALAIFGCLLGYTRISDEMKNPGLVKLVEGIGYDEGLPVVVDPGIISPKKFIDEVIGVRFPNPFMPDTPQRIATDSSQKIPVRFGETIKAYLAGKARDGSGKKLSAGDLRLIPLVLAAWVRYLLGVDDRGQPFTVSPDPLYESLSSGLAGIRLGDAGPFHAALEPILSNSRIFAVNLYEAGLGEKVEALFAELAAGPGAVAAALAKYANR
Sample Types
Isolate
9.5%
Metagenome
90.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.5%
Unclassified
27.8%
Kalotermitidae
25.9%
Termopsidae
5.6%
Rhinotermitidae
3.7%
Passalidae
3.7%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 2 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 3 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 24 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 27 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 35 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 36 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 52 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 53 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_028178 | 3300042615 | Bacteria | 8580 |
| 2 | Ga0466726_418717 | 3300042619 | Bacteria | 6675 |
| 3 | Ga0466728_329053 | 3300042620 | Bacteria | 3796 |
| 4 | Ga0123355_10004470 | 3300009826 | Bacteria | 20344 |
| 5 | Ga0123355_10313410 | 3300009826 | Bacteria | 2123 |
| 6 | Ga0123353_10136626 | 3300010167 | Bacteria | 3932 |
| 7 | Ga0123353_10379229 | 3300010167 | Bacteria | 2116 |
| 8 | Ga0466691_043778 | 3300042593 | Bacteria | 3022 |
| 9 | Ga0466694_174349 | 3300042594 | Bacteria | 93398 |
| 10 | Ga0466699_012984 | 3300042597 | Bacteria | 13934 |
| 11 | Ga0466699_022579 | 3300042597 | Bacteria | 7803 |
| 12 | 2227619062 | 2225789004 | Bacteria | 44796 |
| 13 | JGI24698J34947_10006007 | 3300002449 | Bacteria | 6663 |
| 14 | JGI24698J34947_10008176 | 3300002449 | Unclassified | 5737 |
| 15 | JGI24699J35502_11112013 | 3300002509 | Bacteria | 2743 |
| 16 | Ga0466735_013617 | 3300042624 | Bacteria | 4842 |
| 17 | Ga0466735_158088 | 3300042624 | Bacteria | 3277 |
| 18 | Ga0466735_206155 | 3300042624 | Unclassified | 9266 |
| 19 | Ga0466704_086877 | 3300042643 | Bacteria | 7537 |
| 20 | Ga0466708_127853 | 3300042652 | Bacteria | 8794 |
| 21 | Ga0466722_015416 | 3300042609 | Bacteria | 6021 |
| 22 | Ga0466728_044431 | 3300042620 | Bacteria | 5463 |
| 23 | Ga0466728_265382 | 3300042620 | Bacteria | 4225 |
| 24 | Ga0123355_10012500 | 3300009826 | Bacteria | 13152 |
| 25 | Ga0123355_10017737 | 3300009826 | Bacteria | 11257 |
| 26 | Ga0123353_10046012 | 3300010167 | Bacteria | 6930 |
| 27 | Ga0466692_022555 | 3300042591 | Bacteria | 7165 |
| 28 | Ga0466692_177586 | 3300042591 | Bacteria | 2084 |
| 29 | JGI24698J34947_10017469 | 3300002449 | Bacteria | 3887 |
| 30 | JGI24698J34947_10019662 | 3300002449 | Bacteria | 3640 |
| 31 | JGI24695J34938_10004453 | 3300002450 | Bacteria | 9173 |
| 32 | Ga0072941_1082826 | 3300005201 | Bacteria | 3728 |
| 33 | Ga0123357_10002505 | 3300009784 | Bacteria | 20550 |
| 34 | Ga0466709_007118 | 3300042648 | Bacteria | 4461 |
| 35 | Ga0466727_076650 | 3300042655 | Bacteria | 3074 |
| 36 | Ga0466716_489728 | 3300042605 | Bacteria | 6499 |
| 37 | Ga0466719_166339 | 3300042606 | Bacteria | 3261 |
| 38 | Ga0466722_113985 | 3300042609 | Bacteria | 2797 |
| 39 | Ga0466705_303983 | 3300042612 | Bacteria | 4781 |
| 40 | Ga0466712_270711 | 3300042614 | Unclassified | 2173 |
| 41 | Ga0466715_000572 | 3300042616 | Bacteria | 21083 |
| 42 | Ga0466715_085883 | 3300042616 | Bacteria | 11517 |
| 43 | Ga0466715_214768 | 3300042616 | Bacteria | 3836 |
| 44 | Ga0466723_026492 | 3300042618 | Bacteria | 13737 |
| 45 | Ga0466723_271554 | 3300042618 | Bacteria | 2132 |
| 46 | Ga0466726_322425 | 3300042619 | Bacteria | 4017 |
| 47 | Ga0123353_10299352 | 3300010167 | Bacteria | 2456 |
| 48 | Ga0466692_012723 | 3300042591 | Bacteria | 2647 |
| 49 | Ga0466694_182073 | 3300042594 | Bacteria | 7292 |
| 50 | Ga0466696_031779 | 3300042596 | Bacteria | 2318 |
| 51 | Ga0466696_328442 | 3300042596 | Bacteria | 4025 |
| 52 | Ga0466699_267011 | 3300042597 | Bacteria | 5079 |
| 53 | Ga0466731_178797 | 3300042622 | Bacteria | 9919 |
| 54 | Ga0466703_153313 | 3300042636 | Bacteria | 3006 |
| 55 | Ga0466704_046904 | 3300042643 | Bacteria | 74594 |
| 56 | Ga0466727_232510 | 3300042655 | Bacteria | 3814 |
| 57 | Ga0466706_249494 | 3300042599 | Bacteria | 5757 |
| 58 | Ga0466700_090760 | 3300042600 | Bacteria | 2025 |
| 59 | Ga0466714_116386 | 3300042603 | Bacteria | 12704 |
| 60 | Ga0466719_099995 | 3300042606 | Bacteria | 30212 |
| 61 | Ga0466705_358816 | 3300042612 | Bacteria | 10532 |
| 62 | Ga0466712_161558 | 3300042614 | Bacteria | 10810 |
| 63 | Ga0466712_221722 | 3300042614 | Bacteria | 3116 |
| 64 | Ga0466712_268672 | 3300042614 | Bacteria | 7565 |
| 65 | Ga0466715_293742 | 3300042616 | Bacteria | 13394 |
| 66 | Ga0466723_035304 | 3300042618 | Bacteria | 10567 |
| 67 | Ga0466723_203772 | 3300042618 | Bacteria | 19194 |
| 68 | Ga0466723_266186 | 3300042618 | Bacteria | 9062 |
| 69 | Ga0123354_10086389 | 3300010882 | Bacteria | 4384 |
| 70 | Ga0466696_037623 | 3300042596 | Bacteria | 3504 |
| 71 | 2227535733 | 2225789004 | Bacteria | 56982 |
| 72 | IMNBL1DRAFT_c0003760 | 3300000062 | Bacteria | 9494 |
| 73 | Ga0072941_1029365 | 3300005201 | Bacteria | 4323 |
| 74 | Ga0466708_151170 | 3300042652 | Bacteria | 4559 |
| 75 | Ga0466727_286858 | 3300042655 | Bacteria | 10127 |
| 76 | Ga0466700_034560 | 3300042600 | Bacteria | 2402 |
| 77 | Ga0466716_272535 | 3300042605 | Bacteria | 7095 |
| 78 | Ga0466719_291614 | 3300042606 | Bacteria | 4138 |
| 79 | Ga0466719_495967 | 3300042606 | Bacteria | 34420 |
| 80 | Ga0466719_566229 | 3300042606 | Bacteria | 7273 |
| 81 | Ga0466722_013101 | 3300042609 | Bacteria | 4093 |
| 82 | Ga0466705_105062 | 3300042612 | Bacteria | 2742 |
| 83 | Ga0466712_224220 | 3300042614 | Bacteria | 2399 |
| 84 | Ga0466715_092553 | 3300042616 | Bacteria | 8988 |
| 85 | Ga0466718_098532 | 3300042617 | Bacteria | 1796 |
| 86 | Ga0466723_050728 | 3300042618 | Bacteria | 15848 |
| 87 | Ga0123353_10091039 | 3300010167 | Bacteria | 4913 |
| 88 | Ga0466690_336516 | 3300042590 | Bacteria | 3187 |
| 89 | Ga0466691_072487 | 3300042593 | Bacteria | 1765 |
| 90 | Ga0466694_033022 | 3300042594 | Bacteria | 4521 |
| 91 | JGI24698J34947_10002539 | 3300002449 | Bacteria | 9845 |
| 92 | JGI24702J35022_10014899 | 3300002462 | Bacteria | 4283 |
| 93 | Ga0466703_196810 | 3300042636 | Bacteria | 23282 |
| 94 | Ga0466704_316074 | 3300042643 | Bacteria | 8689 |
| 95 | Ga0466708_375734 | 3300042652 | Bacteria | 1798 |
| 96 | Ga0466708_394234 | 3300042652 | Bacteria | 4475 |
| 97 | Ga0466706_186490 | 3300042599 | Bacteria | 3566 |
| 98 | Ga0466707_344354 | 3300042601 | Bacteria | 15444 |
| 99 | Ga0466722_027767 | 3300042609 | Bacteria | 12522 |
| 100 | Ga0466705_352828 | 3300042612 | Unclassified | 17932 |
| 101 | Ga0466712_216357 | 3300042614 | Bacteria | 4448 |
| 102 | Ga0466712_256792 | 3300042614 | Bacteria | 2681 |
| 103 | Ga0466726_337141 | 3300042619 | Bacteria | 9385 |
| 104 | Ga0123357_10238083 | 3300009784 | Bacteria | 1978 |
| 105 | Ga0123355_10002472 | 3300009826 | Bacteria | 26156 |
| 106 | Ga0466690_086567 | 3300042590 | Bacteria | 12041 |
| 107 | Ga0466692_032386 | 3300042591 | Bacteria | 4232 |
| 108 | Ga0466691_081186 | 3300042593 | Bacteria | 8623 |
| 109 | JGI24698J34947_10019670 | 3300002449 | Bacteria | 3639 |
| 110 | JGI24695J34938_10008773 | 3300002450 | Bacteria | 5725 |
| 111 | JGI24702J35022_10000569 | 3300002462 | Bacteria | 22397 |
| 112 | Ga0466708_064393 | 3300042652 | Bacteria | 10010 |
| 113 | Ga0466719_023777 | 3300042606 | Bacteria | 34238 |
| 114 | Ga0466722_027106 | 3300042609 | Bacteria | 24794 |
| 115 | Ga0466711_207356 | 3300042615 | Bacteria | 11789 |
| 116 | Ga0466715_279182 | 3300042616 | Bacteria | 2450 |
| 117 | Ga0466690_268690 | 3300042590 | Bacteria | 2484 |
| 118 | Ga0466692_014609 | 3300042591 | Bacteria | 5698 |
| 119 | Ga0466692_116451 | 3300042591 | Bacteria | 68874 |
| 120 | Ga0466699_377194 | 3300042597 | Bacteria | 8094 |
| 121 | JGI24698J34947_10012550 | 3300002449 | Bacteria | 4643 |
| 122 | Ga0466703_073385 | 3300042636 | Bacteria | 13449 |
| 123 | Ga0466708_222737 | 3300042652 | Bacteria | 3661 |
| 124 | Ga0466719_141686 | 3300042606 | Bacteria | 2060 |
| 125 | Ga0466719_374227 | 3300042606 | Bacteria | 9159 |
| 126 | Ga0466722_076528 | 3300042609 | Bacteria | 6857 |
| 127 | Ga0466705_167880 | 3300042612 | Bacteria | 18008 |
| 128 | Ga0466705_499599 | 3300042612 | Bacteria | 15319 |
| 129 | Ga0466715_032785 | 3300042616 | Unclassified | 16745 |
| 130 | Ga0123355_10147990 | 3300009826 | Bacteria | 3575 |
| 131 | Ga0123356_10004081 | 3300010049 | Bacteria | 15173 |
| 132 | Ga0123353_10352112 | 3300010167 | Bacteria | 2218 |
| 133 | Ga0466690_189235 | 3300042590 | Bacteria | 3883 |
| 134 | Ga0072941_1031725 | 3300005201 | Bacteria | 5073 |
| 135 | Ga0466735_225701 | 3300042624 | Bacteria | 1866 |
| 136 | Ga0466703_150800 | 3300042636 | Bacteria | 19852 |
| 137 | Ga0466703_239782 | 3300042636 | Bacteria | 17931 |
| 138 | Ga0466707_229553 | 3300042601 | Bacteria | 3936 |
| 139 | Ga0466716_236050 | 3300042605 | Bacteria | 14149 |
| 140 | Ga0466722_041597 | 3300042609 | Bacteria | 7976 |
| 141 | Ga0466722_046095 | 3300042609 | Bacteria | 6932 |
| 142 | Ga0466722_214743 | 3300042609 | Bacteria | 5486 |
| 143 | Ga0466722_230071 | 3300042609 | Bacteria | 9442 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01232 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.