Protein Family IF09978
Metagenome
Isolate
264
Members
240
Samples
71
Scaffolds
233.1
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_324291|Ga0466708_324291_11977_12780
- Length
- 267 aa
- Sequence
- MSVPGVVQKSIGRYTASPHADSKIQWIMSAIEANLQAVRQRISAAAEQSGRSAMDISLLAVSKTRPASDVQAAVLAGQYRFGENYAQEGVDKILALRALRMQGQLPEAAKLEWHFIGPLQSNKTRLVAEYFDWAHSIERLKIADRLSAQRPAQLLPLQVCVQVNVSGEASKSGCPPEEALALCQAVAALPRLKLRGLMCIPAPARDFPAQCRPFARLRQLFETIGAQCPTLDTLSMGMSDDLEAAVQSGGTLLRIGSAIFGKRQNKD
Sample Types
Isolate
73.1%
Metagenome
26.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
37.3%
Coreidae
32.2%
Unclassified
8.1%
Kalotermitidae
5.1%
Elmidae
4.7%
Termitidae
4.2%
Culicidae
2.1%
Curculionidae
1.3%
Rhinotermitidae
0.8%
Berytidae
0.8%
Drosophilidae
0.4%
Formicidae
0.4%
Termopsidae
0.4%
Armadillidiidae
0.4%
Tenebrionidae
0.4%
Hodotermitidae
0.4%
Calliphoridae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
0
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 2 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 3 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 4 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 5 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 6 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 7 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 8 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 9 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 10 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 11 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 12 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 13 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 14 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 15 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 16 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 17 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 18 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 22 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 23 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 24 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 25 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 26 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 27 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 28 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 29 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 30 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 31 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 32 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 36 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 37 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 38 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 39 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 40 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 41 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 42 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 43 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 44 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 45 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 46 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 47 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 48 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 49 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 50 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 51 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 52 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 53 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 59 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 60 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 61 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 62 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 63 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 66 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 67 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 68 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 69 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 70 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 71 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 72 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 73 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 74 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 75 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 76 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 77 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 78 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 79 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 80 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 81 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 82 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 83 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 84 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 85 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 86 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 87 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 88 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 89 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 90 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 91 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 92 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 93 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 94 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 95 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 96 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 97 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 98 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 99 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 100 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 101 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 102 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 103 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 104 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 105 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 106 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 107 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 108 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 109 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 110 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 111 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 112 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 113 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 114 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 115 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 116 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 117 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 118 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 119 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 120 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 121 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 122 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 123 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 124 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 125 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 126 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 127 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 128 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 129 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 130 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 131 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 132 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 133 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 134 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 135 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 136 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 137 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 138 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 139 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 140 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 141 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 142 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 143 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 144 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 145 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 146 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 147 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 148 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 149 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 150 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 151 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 152 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 153 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 154 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 155 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 156 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 157 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 158 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 159 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 160 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 161 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 162 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 163 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 164 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 165 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 166 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 167 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 168 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 169 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 170 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 171 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 172 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 173 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 174 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 175 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 176 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 177 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 178 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 179 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 180 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 181 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 182 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 183 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 184 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 185 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 186 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 187 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 188 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 189 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 190 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 191 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 192 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 193 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 194 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 195 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 196 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 197 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 198 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 199 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 200 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 201 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 202 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 203 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 204 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 205 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 206 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 207 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 208 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 209 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 210 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 211 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 212 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 213 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 214 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 215 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 216 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 217 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 218 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 219 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 220 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 221 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 222 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 223 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 224 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 225 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 226 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 227 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 228 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 229 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 230 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 231 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 232 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 233 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 234 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 235 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 236 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 237 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 238 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 239 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 240 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_340002 | 3300042616 | Bacteria | 4969 |
| 2 | Ga0160447_100436 | 3300012849 | Bacteria | 20385 |
| 3 | HBC_ctgsDRAFT_1028771 | 3300000333 | Unclassified | 1364 |
| 4 | Ga0466717_114548 | 3300042604 | Bacteria | 5206 |
| 5 | Ga0466719_052539 | 3300042606 | Bacteria | 15950 |
| 6 | Ga0466710_376754 | 3300042613 | Bacteria | 1933 |
| 7 | Ga0466711_384001 | 3300042615 | Bacteria | 14197 |
| 8 | Ga0466728_134467 | 3300042620 | Bacteria | 20390 |
| 9 | Ga0466691_066385 | 3300042593 | Bacteria | 2471 |
| 10 | Ga0466699_397542 | 3300042597 | Bacteria | 2931 |
| 11 | SPBB_contig11595 | 2044078006 | Bacteria | 21514 |
| 12 | SCG598I22_12240 | 3300000462 | Bacteria | 19127 |
| 13 | Ga0562378_0083 | 3300056814 | Bacteria | 261378 |
| 14 | Ga0466706_206122 | 3300042599 | Bacteria | 2178 |
| 15 | Ga0466719_145905 | 3300042606 | Bacteria | 12080 |
| 16 | Ga0466710_052779 | 3300042613 | Bacteria | 1340 |
| 17 | Ga0466710_249192 | 3300042613 | Bacteria | 63183 |
| 18 | Ga0466715_036071 | 3300042616 | Bacteria | 24043 |
| 19 | Ga0466729_016426 | 3300042621 | Bacteria | 23520 |
| 20 | Ga0160472_100377 | 3300012839 | Bacteria | 38041 |
| 21 | FGTW_contig30847 | 2065487013 | Bacteria | 8638 |
| 22 | gam1t_NODE_271136_length=37950_GC=34_8_Contigs=6 | 2189573031 | Bacteria | 38000 |
| 23 | Ga0105524_103041 | 3300007733 | Bacteria | 2670 |
| 24 | Ga0466715_355522 | 3300042616 | Bacteria | 36627 |
| 25 | Ga0466726_022226 | 3300042619 | Bacteria | 1181 |
| 26 | Ga0160467_101918 | 3300012829 | Unclassified | 5970 |
| 27 | Ga0160470_100100 | 3300012813 | Bacteria | 101166 |
| 28 | gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 | 2189573031 | Bacteria | 78604 |
| 29 | SCG598L16_135354 | 3300000490 | Unclassified | 29460 |
| 30 | Ga0466708_324291 | 3300042652 | Bacteria | 19723 |
| 31 | Ga0466707_087845 | 3300042601 | Bacteria | 2339 |
| 32 | Ga0466716_202498 | 3300042605 | Bacteria | 2166 |
| 33 | Ga0466712_041405 | 3300042614 | Bacteria | 4759 |
| 34 | Ga0466711_191387 | 3300042615 | Bacteria | 3186 |
| 35 | Ga0466723_100869 | 3300042618 | Bacteria | 18431 |
| 36 | Ga0466657_272357 | 3300042582 | Bacteria | 12531 |
| 37 | Ga0466690_012085 | 3300042590 | Bacteria | 20404 |
| 38 | gam1t_NODE_232935_length=10061_GC=32_9_Contigs=4 | 2189573031 | Bacteria | 10091 |
| 39 | gam1t_NODE_685166_length=13492_GC=34_3_Contigs=2 | 2189573031 | Unclassified | 13502 |
| 40 | SCG598O02_11320 | 3300000460 | Bacteria | 19128 |
| 41 | Ga0074278_128980 | 3300005721 | Unclassified | 78604 |
| 42 | Ga0104040_1041390 | 3300007149 | Bacteria | 4179 |
| 43 | Ga0123357_10000009 | 3300009784 | Bacteria | 204245 |
| 44 | Ga0466734_080560 | 3300042623 | Bacteria | 12255 |
| 45 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 46 | Ga0466725_409024 | 3300042654 | Bacteria | 23019 |
| 47 | Ga0160440_100169 | 3300012815 | Bacteria | 55619 |
| 48 | Ga0160447_105929 | 3300012849 | Unclassified | 3303 |
| 49 | Ga0466692_167406 | 3300042591 | Bacteria | 107532 |
| 50 | Ga0123353_10000514 | 3300010167 | Bacteria | 47868 |
| 51 | Ga0160466_100186 | 3300012809 | Bacteria | 47189 |
| 52 | SCG598L16_135911 | 3300000490 | Unclassified | 45650 |
| 53 | Ga0104147_1028207 | 3300007224 | Bacteria | 5507 |
| 54 | Ga0466703_015438 | 3300042636 | Bacteria | 14763 |
| 55 | Ga0466708_039324 | 3300042652 | Bacteria | 18031 |
| 56 | Ga0466701_045882 | 3300042598 | Bacteria | 11508 |
| 57 | Ga0466719_546594 | 3300042606 | Bacteria | 14451 |
| 58 | Ga0466726_053798 | 3300042619 | Bacteria | 5537 |
| 59 | Ga0160460_101125 | 3300012845 | Bacteria | 10490 |
| 60 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 61 | Ga0466691_023612 | 3300042593 | Bacteria | 17170 |
| 62 | HBC_ctgsDRAFT_1015816 | 3300000333 | Unclassified | 1831 |
| 63 | Ga0074278_108760 | 3300005721 | Bacteria | 38000 |
| 64 | Ga0466704_132280 | 3300042643 | Bacteria | 33822 |
| 65 | Ga0466725_080781 | 3300042654 | Bacteria | 1255 |
| 66 | Ga0466725_375239 | 3300042654 | Bacteria | 27664 |
| 67 | Ga0466706_137103 | 3300042599 | Bacteria | 2888 |
| 68 | Ga0466705_084923 | 3300042612 | Bacteria | 13395 |
| 69 | Ga0160472_100558 | 3300012839 | Bacteria | 22546 |
| 70 | Ga0466708_092921 | 3300042652 | Bacteria | 15843 |
| 71 | Ga0466708_138327 | 3300042652 | Bacteria | 16274 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain | 34 | 263 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.