Protein Family IF09969
Metagenome
Isolate
190
Members
71
Samples
161
Scaffolds
277.19
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_306530|Ga0466708_306530_1397_2368
- Length
- 323 aa
- Sequence
- MQEEISYLTAILQQRLQKSQISLLNGFAMMYNGITGLLRGLRKEGRAMSRADDIFIGMCRDILENGFSSEGQIVRARWADGAPAHTIKRFGVINRYDLAEEFPALTLRPTPLRLCVDELLWIWQKKSNNTADLNSRIWDAWADENGSIGKAYGYQLGVRYKFGHGETDQVDNVLWQLKNTPYSRRILTNIYRFEDLHEMALEPCAYSMTFNVTGNRLNAILNQRSQDILTANNWNVVQYAVLLCMFAQVSGLLPGELVHVIADAHIYDRHVPIIREMLARKTHAAPTFWLNGRVKDFYGFTPDDAVFENYETNPQIKDIPVAV
Sample Types
Isolate
15.3%
Metagenome
84.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
41.4%
Termitidae
27.1%
Kalotermitidae
17.1%
Termopsidae
4.3%
Passalidae
2.9%
Rhinotermitidae
2.9%
Hodotermitidae
1.4%
Pyrrhocoridae
1.4%
Blattidae
1.4%
Taxonomy
Archaea
1
Bacteria
180
Eukaryota
0
Viruses
1
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 3 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 4 | 2820378768 | Unclassified Firmicutes Nt197P1bin7 | Isolate | Unclassified |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 7 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 8 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 9 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 10 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 18 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 25 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 26 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 42 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 43 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 44 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 45 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 53 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 54 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 55 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 56 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 57 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 58 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 63 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 64 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 65 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 68 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_110975 | 3300042659 | Bacteria | 1849 |
| 2 | Ga0466706_274199 | 3300042599 | Bacteria | 2580 |
| 3 | Ga0466707_247189 | 3300042601 | Bacteria | 129032 |
| 4 | Ga0466714_003045 | 3300042603 | Bacteria | 3508 |
| 5 | Ga0466719_018181 | 3300042606 | Bacteria | 9978 |
| 6 | Ga0466719_142258 | 3300042606 | Bacteria | 1276 |
| 7 | Ga0466691_169967 | 3300042593 | Bacteria | 4979 |
| 8 | Ga0466696_166612 | 3300042596 | Bacteria | 6759 |
| 9 | Ga0466696_171484 | 3300042596 | Bacteria | 23340 |
| 10 | Ga0123355_10162263 | 3300009826 | Bacteria | 3364 |
| 11 | Ga0123355_10346633 | 3300009826 | Bacteria | 1973 |
| 12 | Ga0123356_10000721 | 3300010049 | Bacteria | 36554 |
| 13 | Ga0123356_10370005 | 3300010049 | Bacteria | 1563 |
| 14 | Ga0123353_10000564 | 3300010167 | Bacteria | 45563 |
| 15 | Ga0466723_109143 | 3300042618 | Bacteria | 3329 |
| 16 | Ga0466702_073138 | 3300042635 | Archaea | 1826 |
| 17 | Ga0466704_263396 | 3300042643 | Bacteria | 2660 |
| 18 | Ga0466725_144954 | 3300042654 | Bacteria | 8759 |
| 19 | Ga0466705_001522 | 3300042612 | Bacteria | 1481 |
| 20 | Ga0466733_075695 | 3300042659 | Bacteria | 1258 |
| 21 | Ga0466706_033677 | 3300042599 | Bacteria | 2120 |
| 22 | Ga0466700_112646 | 3300042600 | Bacteria | 3570 |
| 23 | Ga0415639_008224 | 3300038395 | Bacteria | 14528 |
| 24 | Ga0466692_050092 | 3300042591 | Bacteria | 12624 |
| 25 | Ga0123355_10084078 | 3300009826 | Bacteria | 5070 |
| 26 | Ga0123356_10032788 | 3300010049 | Bacteria | 4857 |
| 27 | Ga0123354_10155681 | 3300010882 | Bacteria | 2743 |
| 28 | Ga0466711_410396 | 3300042615 | Bacteria | 10151 |
| 29 | Ga0466715_113254 | 3300042616 | Bacteria | 52859 |
| 30 | Ga0466715_473659 | 3300042616 | Bacteria | 1762 |
| 31 | Ga0466735_101620 | 3300042624 | Bacteria | 4854 |
| 32 | Ga0466703_126400 | 3300042636 | Bacteria | 1999 |
| 33 | Ga0466703_328785 | 3300042636 | Bacteria | 2731 |
| 34 | Ga0466703_373440 | 3300042636 | Bacteria | 6400 |
| 35 | Ga0466704_327822 | 3300042643 | Bacteria | 22904 |
| 36 | Ga0466725_161651 | 3300042654 | Bacteria | 1244 |
| 37 | 2227648799 | 2225789004 | Bacteria | 2014 |
| 38 | IMNBL1DRAFT_c0000109 | 3300000062 | Bacteria | 73607 |
| 39 | Ga0072941_1264664 | 3300005201 | Bacteria | 1908 |
| 40 | Ga0466697_098673 | 3300042611 | Bacteria | 2562 |
| 41 | Ga0466707_205073 | 3300042601 | Bacteria | 53746 |
| 42 | Ga0466716_089134 | 3300042605 | Bacteria | 5982 |
| 43 | Ga0466722_080127 | 3300042609 | Bacteria | 2218 |
| 44 | Ga0415639_055344 | 3300038395 | Bacteria | 10864 |
| 45 | Ga0123357_10049815 | 3300009784 | Bacteria | 5672 |
| 46 | Ga0123357_10270853 | 3300009784 | Bacteria | 1775 |
| 47 | Ga0123355_10000126 | 3300009826 | Bacteria | 88567 |
| 48 | Ga0123355_10000159 | 3300009826 | Bacteria | 81982 |
| 49 | Ga0123355_10000243 | 3300009826 | Bacteria | 70132 |
| 50 | Ga0123355_10000349 | 3300009826 | Bacteria | 59735 |
| 51 | Ga0123355_10048016 | 3300009826 | Bacteria | 6938 |
| 52 | Ga0123353_10000636 | 3300010167 | Bacteria | 42832 |
| 53 | Ga0123353_10209981 | 3300010167 | Bacteria | 3054 |
| 54 | Ga0123353_11013649 | 3300010167 | Unclassified | 1114 |
| 55 | Ga0466715_031622 | 3300042616 | Bacteria | 3777 |
| 56 | Ga0466723_319684 | 3300042618 | Bacteria | 9373 |
| 57 | Ga0466723_336477 | 3300042618 | Bacteria | 3070 |
| 58 | Ga0466728_018896 | 3300042620 | Bacteria | 10766 |
| 59 | Ga0466728_362462 | 3300042620 | Bacteria | 2413 |
| 60 | 2227466310 | 2225789004 | Bacteria | 24399 |
| 61 | IMNBL1DRAFT_c0000002 | 3300000062 | Bacteria | 288751 |
| 62 | IMNBL1DRAFT_c0001242 | 3300000062 | Bacteria | 19229 |
| 63 | IMNBL1DRAFT_c0017242 | 3300000062 | Bacteria | 3049 |
| 64 | JGI24695J34938_10020112 | 3300002450 | Bacteria | 3291 |
| 65 | JGI24703J35330_11729111 | 3300002501 | Bacteria | 2648 |
| 66 | Ga0072941_1526006 | 3300005201 | Bacteria | 3308 |
| 67 | Ga0466706_157183 | 3300042599 | Bacteria | 1196 |
| 68 | Ga0466707_011359 | 3300042601 | Bacteria | 2045 |
| 69 | Ga0466707_187385 | 3300042601 | Bacteria | 22990 |
| 70 | Ga0466713_098236 | 3300042602 | Bacteria | 111747 |
| 71 | Ga0466714_164875 | 3300042603 | Bacteria | 1245 |
| 72 | Ga0466717_120259 | 3300042604 | Bacteria | 5039 |
| 73 | Ga0466722_076558 | 3300042609 | Bacteria | 37126 |
| 74 | Ga0466722_227431 | 3300042609 | Bacteria | 3690 |
| 75 | Ga0415639_068793 | 3300038395 | Bacteria | 2742 |
| 76 | Ga0123357_10441423 | 3300009784 | Bacteria | 1139 |
| 77 | Ga0123355_10014205 | 3300009826 | Bacteria | 12438 |
| 78 | Ga0123356_10064597 | 3300010049 | Bacteria | 3422 |
| 79 | Ga0123353_10048606 | 3300010167 | Bacteria | 6755 |
| 80 | Ga0123353_10052925 | 3300010167 | Bacteria | 6487 |
| 81 | 2227659077 | 2225789004 | Bacteria | 1957 |
| 82 | Ga0466707_330489 | 3300042601 | Bacteria | 25548 |
| 83 | Ga0466719_233762 | 3300042606 | Bacteria | 9801 |
| 84 | Ga0123355_10266092 | 3300009826 | Bacteria | 2390 |
| 85 | Ga0123355_10354454 | 3300009826 | Viruses | 1940 |
| 86 | Ga0123355_10442927 | 3300009826 | Bacteria | 1643 |
| 87 | Ga0466711_461197 | 3300042615 | Bacteria | 2970 |
| 88 | Ga0466715_011264 | 3300042616 | Bacteria | 5291 |
| 89 | Ga0466715_315713 | 3300042616 | Bacteria | 1660 |
| 90 | Ga0466715_551337 | 3300042616 | Bacteria | 1577 |
| 91 | Ga0466718_126333 | 3300042617 | Bacteria | 3950 |
| 92 | Ga0466726_412412 | 3300042619 | Bacteria | 8604 |
| 93 | Ga0466728_328233 | 3300042620 | Bacteria | 22867 |
| 94 | Ga0466703_162978 | 3300042636 | Bacteria | 7180 |
| 95 | Ga0466703_175771 | 3300042636 | Bacteria | 3523 |
| 96 | Ga0466708_306530 | 3300042652 | Bacteria | 3451 |
| 97 | Ga0466727_245681 | 3300042655 | Bacteria | 65513 |
| 98 | 2227088610 | 2225789004 | Unclassified | 1844 |
| 99 | JGI24703J35330_11748685 | 3300002501 | Bacteria | 24839 |
| 100 | JGI24705J35276_12236795 | 3300002504 | Bacteria | 8941 |
| 101 | Ga0466697_129079 | 3300042611 | Bacteria | 4723 |
| 102 | Ga0466706_114876 | 3300042599 | Bacteria | 50229 |
| 103 | Ga0466706_255912 | 3300042599 | Bacteria | 2017 |
| 104 | Ga0466713_020113 | 3300042602 | Bacteria | 3875 |
| 105 | Ga0466713_140418 | 3300042602 | Bacteria | 8787 |
| 106 | Ga0466714_077851 | 3300042603 | Bacteria | 5468 |
| 107 | Ga0466719_387248 | 3300042606 | Bacteria | 2289 |
| 108 | Ga0415639_011208 | 3300038395 | Bacteria | 31298 |
| 109 | Ga0466693_222810 | 3300042592 | Unclassified | 1104 |
| 110 | Ga0466691_145911 | 3300042593 | Bacteria | 1032 |
| 111 | Ga0466696_220189 | 3300042596 | Bacteria | 3531 |
| 112 | Ga0123357_10094435 | 3300009784 | Bacteria | 3882 |
| 113 | Ga0123355_10000061 | 3300009826 | Bacteria | 114819 |
| 114 | Ga0123355_10016588 | 3300009826 | Bacteria | 11616 |
| 115 | Ga0466712_106654 | 3300042614 | Bacteria | 1020 |
| 116 | Ga0466715_044861 | 3300042616 | Bacteria | 8575 |
| 117 | Ga0466702_195867 | 3300042635 | Bacteria | 1818 |
| 118 | Ga0466703_421542 | 3300042636 | Bacteria | 6641 |
| 119 | Ga0466704_503225 | 3300042643 | Bacteria | 1527 |
| 120 | Ga0466725_218258 | 3300042654 | Bacteria | 1290 |
| 121 | 2227574638 | 2225789004 | Bacteria | 13657 |
| 122 | Ga0466705_201621 | 3300042612 | Bacteria | 6618 |
| 123 | Ga0466733_096793 | 3300042659 | Bacteria | 1557 |
| 124 | Ga0466733_165043 | 3300042659 | Bacteria | 7273 |
| 125 | Ga0466706_090940 | 3300042599 | Bacteria | 8193 |
| 126 | Ga0466714_020125 | 3300042603 | Unclassified | 2303 |
| 127 | Ga0466717_188447 | 3300042604 | Bacteria | 3691 |
| 128 | Ga0466719_365762 | 3300042606 | Bacteria | 13994 |
| 129 | Ga0466693_301181 | 3300042592 | Unclassified | 1043 |
| 130 | Ga0466696_040394 | 3300042596 | Bacteria | 8029 |
| 131 | Ga0123355_10669943 | 3300009826 | Unclassified | 1203 |
| 132 | Ga0123356_10373192 | 3300010049 | Bacteria | 1557 |
| 133 | Ga0466715_380588 | 3300042616 | Bacteria | 2022 |
| 134 | Ga0466715_548686 | 3300042616 | Bacteria | 4418 |
| 135 | Ga0466723_250388 | 3300042618 | Bacteria | 22848 |
| 136 | Ga0466728_057207 | 3300042620 | Bacteria | 1968 |
| 137 | Ga0466735_216203 | 3300042624 | Bacteria | 1063 |
| 138 | Ga0466727_309089 | 3300042655 | Bacteria | 7910 |
| 139 | Ga0466705_320068 | 3300042612 | Bacteria | 8875 |
| 140 | Ga0466733_213289 | 3300042659 | Bacteria | 1735 |
| 141 | Ga0466713_000408 | 3300042602 | Bacteria | 8250 |
| 142 | Ga0466713_093732 | 3300042602 | Bacteria | 2784 |
| 143 | Ga0466713_137378 | 3300042602 | Bacteria | 2827 |
| 144 | Ga0466717_224341 | 3300042604 | Bacteria | 7561 |
| 145 | Ga0466719_398712 | 3300042606 | Bacteria | 71100 |
| 146 | Ga0123355_10001676 | 3300009826 | Bacteria | 30851 |
| 147 | Ga0123355_10026341 | 3300009826 | Bacteria | 9379 |
| 148 | Ga0123355_10065713 | 3300009826 | Bacteria | 5842 |
| 149 | Ga0123356_10009025 | 3300010049 | Bacteria | 9865 |
| 150 | Ga0123356_10199575 | 3300010049 | Unclassified | 2039 |
| 151 | Ga0123353_10001219 | 3300010167 | Bacteria | 31498 |
| 152 | Ga0123353_10190141 | 3300010167 | Unclassified | 3241 |
| 153 | Ga0466705_493704 | 3300042612 | Bacteria | 31357 |
| 154 | Ga0466728_029225 | 3300042620 | Bacteria | 4750 |
| 155 | Ga0466704_188490 | 3300042643 | Bacteria | 2312 |
| 156 | Ga0466708_070967 | 3300042652 | Bacteria | 147769 |
| 157 | Ga0466708_126454 | 3300042652 | Bacteria | 10437 |
| 158 | Ga0466708_463272 | 3300042652 | Bacteria | 8723 |
| 159 | Ga0466725_076234 | 3300042654 | Bacteria | 6274 |
| 160 | IMNBL1DRAFT_c0001243 | 3300000062 | Bacteria | 19222 |
| 161 | JGI24705J35276_12218310 | 3300002504 | Bacteria | 2137 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00303 | Thymidylat_synt | Thymidylate synthase | 55 | 318 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.