Protein Family IF09959

Metagenome Isolate
157 Members
94 Samples
102 Scaffolds
488.81 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_292103|Ga0466708_292103_6934_8469
Length
511 aa
Sequence
LKPDSVNAFFTRKGIYYVKEHIMSYDLRQAVELLKKNPGQYIETNEPVDCNAELAGVYRYIGAGGTVMRPTQLGPAMMFNKLKDFPDAKVLIGVLASRKRVGLMLNTPPEKLGFLLQKAVVNPIKPVTVPNDKAVCQEVVYKATDPGFDIRKLIPAPTNTPEDAGPYITMGMCYAEDPENDDTDITIHRLCLQSKDEISMYFVPGARHLTVFREKAEKAGKPLPISINIGVDPAMEIAACFEPPTTPLGFCELEIAGAIRNEAVEMTKCLTVDTLCIANAEYVIEGELLPDVRIQEDINTKSGKAMPEFPGYTGLANPSLPVIKVKAVTHRKNPIMQTCIGPSEEHVSMAGIPTEASIIGMVEKAMPGRLINVYAASPGGGKYMAVLQFKKSQPSDEGRQRQAALLAFSAFPELKHVFLVDEDVDPFDINDVIWALNTRYQGNLDTIFIPGVRCHPLDPSQTHDYNINIPDRGISCKTIFDCTVPYAVKDKFQRSKFKEMDYKKFAPDLFK

📊 Sample Types

Isolate 35.0%
Metagenome 65.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Drosophilidae 31.9%
Kalotermitidae 15.4%
Unclassified 14.3%
Termitidae 8.8%
Tenebrionidae 6.6%
Curculionidae 4.4%
Rhinotermitidae 3.3%
Blattidae 3.3%
Termopsidae 3.3%
Rhopalidae 1.1%
Scarabaeidae 1.1%
Pentatomidae 1.1%
Pyrrhocoridae 1.1%
Apidae 1.1%
Formicidae 1.1%
Passalidae 1.1%
Anthocoridae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
2 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
3 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
4 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
5 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
6 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
7 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
8 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
9 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
16 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
17 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
21 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
22 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
23 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
24 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
25 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
26 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
27 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
30 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
33 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
34 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
35 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
36 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
37 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
38 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
41 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
42 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
43 8103002986 Erwinia sp. S38 Isolate Curculionidae
44 8103008710 Erwinia sp. S43 Isolate Curculionidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
50 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
51 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
52 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
55 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
56 651324086 Plautia crossota stali symbiont Isolate Unclassified
57 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
58 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
59 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
60 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
61 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
62 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
63 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
64 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
65 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
66 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
67 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
68 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
69 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
70 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
71 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
72 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
73 8017489919 Lactobacillus brevis EF Isolate Unclassified
74 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
75 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
76 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
77 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
78 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
79 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
80 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
81 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
82 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
83 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
84 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
85 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
86 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
87 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
88 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
89 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
90 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
91 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
92 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
93 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
94 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0197 3300056790 Bacteria 172310
2 Ga0562374_0599 3300057007 Bacteria 56489
3 Ga0466700_485122 3300042600 Bacteria 5284
4 Ga0466713_094422 3300042602 Bacteria 38692
5 Ga0466713_128094 3300042602 Bacteria 4900
6 Ga0466719_545333 3300042606 Bacteria 3770
7 Ga0466703_432001 3300042636 Bacteria 10664
8 Ga0466727_305406 3300042655 Bacteria 5130
9 Ga0466715_491598 3300042616 Bacteria 1621
10 Ga0466726_127689 3300042619 Bacteria 10242
11 Ga0466726_325931 3300042619 Bacteria 11843
12 Ga0123357_10128994 3300009784 Bacteria 3156
13 Ga0123356_10011004 3300010049 Bacteria 8834
14 Ga0123353_10342676 3300010167 Bacteria 2257
15 Ga0123354_10047474 3300010882 Bacteria 6544
16 Ga0456237_0004953 3300041968 Bacteria 2126
17 Ga0466705_005854 3300042612 Bacteria 1845
18 Ga0466705_050551 3300042612 Bacteria 17069
19 Ga0562378_0227 3300056814 Bacteria 131185
20 DPOL_contig03051 2035918003 Unclassified 21538
21 Ga0068302_10034605 3300005071 Bacteria 5018
22 Ga0466730_020932 3300042625 Unclassified 12513
23 Ga0466703_163837 3300042636 Bacteria 2017
24 Ga0466708_121155 3300042652 Bacteria 3928
25 Ga0123356_10057831 3300010049 Bacteria 3615
26 Ga0123353_10193506 3300010167 Bacteria 3207
27 Ga0466692_185360 3300042591 Bacteria 7744
28 Ga0466705_184057 3300042612 Bacteria 4110
29 Ga0466705_366330 3300042612 Bacteria 12125
30 Ga0562379_0039 3300056790 Bacteria 641946
31 Ga0562377_3333 3300056842 Bacteria 8417
32 Ga0063521_1000212 3300003973 Bacteria 41459
33 Ga0466707_055425 3300042601 Bacteria 4996
34 Ga0466707_095742 3300042601 Bacteria 2148
35 Ga0466716_507896 3300042605 Bacteria 5204
36 Ga0466724_39856 3300042649 Bacteria 27534
37 Ga0466723_022750 3300042618 Bacteria 3602
38 Ga0466726_125434 3300042619 Bacteria 6132
39 Ga0466726_426079 3300042619 Bacteria 4637
40 Ga0466729_037591 3300042621 Bacteria 3062
41 Ga0123353_10004883 3300010167 Bacteria 17435
42 Ga0466705_292077 3300042612 Bacteria 13862
43 Ga0562379_0086 3300056790 Bacteria 339972
44 Ga0562379_0356 3300056790 Bacteria 107538
45 Ga0104041_1002182 3300007106 Bacteria 9598
46 Ga0105005_1043052 3300007505 Bacteria 16486
47 Ga0466704_127070 3300042643 Bacteria 39420
48 Ga0466709_012553 3300042648 Bacteria 1953
49 Ga0466708_292103 3300042652 Bacteria 13018
50 Ga0466729_142163 3300042621 Bacteria 2839
51 Ga0466690_139022 3300042590 Bacteria 4788
52 Ga0466691_120156 3300042593 Bacteria 4722
53 Ga0466705_168307 3300042612 Bacteria 17645
54 Ga0562376_4397 3300056857 Unclassified 11787
55 2227161346 2225789004 Unclassified 8380
56 Ga0068305_10062246 3300005083 Bacteria 5279
57 Ga0466707_212989 3300042601 Bacteria 10280
58 Ga0466707_311304 3300042601 Bacteria 2219
59 Ga0466716_331315 3300042605 Bacteria 1531
60 Ga0466705_488108 3300042612 Bacteria 5088
61 Ga0466711_216938 3300042615 Unclassified 3347
62 Ga0466726_355456 3300042619 Bacteria 2389
63 Ga0466729_060874 3300042621 Bacteria 5415
64 Ga0466691_183955 3300042593 Bacteria 29567
65 Ga0466705_283637 3300042612 Bacteria 2002
66 Ga0466733_200362 3300042659 Bacteria 3828
67 Ga0562379_0636 3300056790 Bacteria 61606
68 Ga0562375_2024 3300056856 Unclassified 24325
69 Ga0068302_10103002 3300005071 Bacteria 5310
70 Ga0466704_141402 3300042643 Bacteria 4819
71 Ga0466708_244307 3300042652 Bacteria 44981
72 Ga0466715_428292 3300042616 Bacteria 6823
73 Ga0466726_154436 3300042619 Bacteria 30482
74 Ga0123353_10062278 3300010167 Bacteria 5984
75 Ga0123353_10283374 3300010167 Unclassified 2543
76 Ga0466705_024340 3300042612 Bacteria 2453
77 Ga0562377_0011 3300056842 Bacteria 1259346
78 Ga0562375_0413 3300056856 Unclassified 94291
79 Ga0466704_037008 3300042643 Unclassified 2902
80 Ga0466704_472277 3300042643 Bacteria 5459
81 Ga0466704_512079 3300042643 Bacteria 3225
82 Ga0466724_44338 3300042649 Bacteria 38006
83 Ga0466708_078029 3300042652 Bacteria 2467
84 Ga0466708_121284 3300042652 Bacteria 4205
85 Ga0466727_274135 3300042655 Bacteria 1400
86 Ga0466715_053927 3300042616 Bacteria 25116
87 Ga0466715_208575 3300042616 Bacteria 3228
88 Ga0466726_209703 3300042619 Bacteria 19792
89 Ga0123353_10155305 3300010167 Bacteria 3649
90 Ga0123353_10476210 3300010167 Bacteria 1828
91 Ga0123354_10030784 3300010882 Bacteria 8425
92 Ga0316159_11400 3300030930 Unclassified 3073
93 Ga0466696_336166 3300042596 Bacteria 6632
94 Ga0466705_026821 3300042612 Unclassified 8392
95 Ga0063521_1000277 3300003973 Bacteria 33158
96 Ga0068305_10004524 3300005083 Bacteria 27009
97 Ga0466704_130376 3300042643 Bacteria 60549
98 Ga0466709_353780 3300042648 Bacteria 8097
99 Ga0466715_108828 3300042616 Bacteria 9132
100 Ga0466723_047318 3300042618 Bacteria 23136
101 Ga0123357_10138628 3300009784 Unclassified 2998
102 Ga0123356_10021203 3300010049 Bacteria 6137

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20696 UbiD_C 3-octaprenyl-4-hydroxybenzoate carboxy-lyase C-terminal domain 349 482 0.97
PF01977 UbiD 3-octaprenyl-4-hydroxybenzoate carboxy-lyase Rift-related domain 129 340 0.91
PF20695 UbiD_N 3-octaprenyl-4-hydroxybenzoate carboxy-lyase N-terminal domain 36 113 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.