Protein Family IF09941
Metagenome
Isolate
231
Members
57
Samples
222
Scaffolds
62.19
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_241212|Ga0466708_241212_263_496
- Length
- 77 aa
- Sequence
- MAVPRFKTSKARTRRRQSINMKLTAPTMIECGTCGNKVLLHRVCPKCGFYRGKQVIVPNSKVKTDDKSILKRGFQDG
Sample Types
Isolate
3.9%
Metagenome
96.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.1%
Kalotermitidae
25.0%
Unclassified
17.9%
Rhinotermitidae
7.1%
Termopsidae
5.4%
Blaberidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
198
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 26 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 38 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 49 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 50 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_125615 | 3300042612 | Bacteria | 2865 |
| 2 | JGI24698J34947_10000008 | 3300002449 | Bacteria | 53028 |
| 3 | JGI24695J34938_10012056 | 3300002450 | Bacteria | 4608 |
| 4 | Ga0456237_0016173 | 3300041968 | Bacteria | 1054 |
| 5 | Ga0466692_041724 | 3300042591 | Bacteria | 7596 |
| 6 | Ga0466692_115896 | 3300042591 | Bacteria | 2578 |
| 7 | Ga0466691_072026 | 3300042593 | Bacteria | 6037 |
| 8 | Ga0466691_074690 | 3300042593 | Bacteria | 11649 |
| 9 | Ga0466696_092260 | 3300042596 | Bacteria | 2878 |
| 10 | Ga0466696_157806 | 3300042596 | Bacteria | 1501 |
| 11 | Ga0123353_10465108 | 3300010167 | Bacteria | 1857 |
| 12 | Ga0466716_142458 | 3300042605 | Bacteria | 7056 |
| 13 | Ga0466720_037572 | 3300042607 | Bacteria | 5544 |
| 14 | Ga0466720_209844 | 3300042607 | Bacteria | 24188 |
| 15 | Ga0466729_250651 | 3300042621 | Unclassified | 1380 |
| 16 | Ga0466735_034759 | 3300042624 | Bacteria | 2903 |
| 17 | Ga0466735_180635 | 3300042624 | Unclassified | 1193 |
| 18 | Ga0466704_013401 | 3300042643 | Bacteria | 13479 |
| 19 | Ga0466704_233519 | 3300042643 | Bacteria | 13976 |
| 20 | Ga0466709_415682 | 3300042648 | Bacteria | 14471 |
| 21 | Ga0466708_220152 | 3300042652 | Bacteria | 30844 |
| 22 | Ga0466708_241212 | 3300042652 | Bacteria | 1676 |
| 23 | Ga0466708_395466 | 3300042652 | Unclassified | 1161 |
| 24 | Ga0466727_080587 | 3300042655 | Bacteria | 8292 |
| 25 | Ga0466712_027197 | 3300042614 | Bacteria | 5365 |
| 26 | Ga0466718_170358 | 3300042617 | Bacteria | 4172 |
| 27 | Ga0466723_299230 | 3300042618 | Bacteria | 1561 |
| 28 | Ga0466707_143408 | 3300042601 | Unclassified | 1947 |
| 29 | Ga0466707_416823 | 3300042601 | Unclassified | 1864 |
| 30 | Ga0466719_187916 | 3300042606 | Unclassified | 5041 |
| 31 | Ga0466719_377642 | 3300042606 | Bacteria | 21657 |
| 32 | Ga0466722_101542 | 3300042609 | Bacteria | 9184 |
| 33 | Ga0466735_043744 | 3300042624 | Bacteria | 2574 |
| 34 | Ga0466703_040491 | 3300042636 | Bacteria | 7503 |
| 35 | Ga0466703_206894 | 3300042636 | Unclassified | 6407 |
| 36 | Ga0466704_078126 | 3300042643 | Bacteria | 27054 |
| 37 | Ga0466704_533568 | 3300042643 | Unclassified | 6596 |
| 38 | Ga0466709_345098 | 3300042648 | Bacteria | 7267 |
| 39 | Ga0466727_089588 | 3300042655 | Bacteria | 2467 |
| 40 | Ga0466727_156371 | 3300042655 | Bacteria | 2476 |
| 41 | Ga0466727_346042 | 3300042655 | Bacteria | 1692 |
| 42 | Ga0466712_074642 | 3300042614 | Bacteria | 2764 |
| 43 | Ga0466712_234398 | 3300042614 | Bacteria | 23834 |
| 44 | Ga0466711_342591 | 3300042615 | Bacteria | 80397 |
| 45 | Ga0466715_194069 | 3300042616 | Bacteria | 14816 |
| 46 | Ga0466718_093960 | 3300042617 | Bacteria | 6442 |
| 47 | Ga0466726_068215 | 3300042619 | Unclassified | 2026 |
| 48 | Ga0466726_106991 | 3300042619 | Bacteria | 3710 |
| 49 | Ga0466728_302662 | 3300042620 | Bacteria | 2123 |
| 50 | Ga0466705_209290 | 3300042612 | Bacteria | 3800 |
| 51 | Ga0466705_245707 | 3300042612 | Bacteria | 20002 |
| 52 | JGI24698J34947_10020190 | 3300002449 | Unclassified | 3591 |
| 53 | JGI24698J34947_10072209 | 3300002449 | Unclassified | 1653 |
| 54 | JGI24699J35502_11099808 | 3300002509 | Bacteria | 2330 |
| 55 | Ga0466690_253477 | 3300042590 | Bacteria | 1319 |
| 56 | Ga0466690_357863 | 3300042590 | Bacteria | 6754 |
| 57 | Ga0466695_008822 | 3300042595 | Bacteria | 36749 |
| 58 | Ga0123355_10023690 | 3300009826 | Bacteria | 9860 |
| 59 | Ga0123356_12320024 | 3300010049 | Unclassified | 671 |
| 60 | Ga0123353_10140711 | 3300010167 | Bacteria | 3866 |
| 61 | Ga0466700_472878 | 3300042600 | Bacteria | 1042 |
| 62 | Ga0466707_174171 | 3300042601 | Bacteria | 1799 |
| 63 | Ga0466713_115275 | 3300042602 | Bacteria | 2063 |
| 64 | Ga0466716_224206 | 3300042605 | Bacteria | 6507 |
| 65 | Ga0466716_406294 | 3300042605 | Bacteria | 15802 |
| 66 | Ga0466719_405635 | 3300042606 | Bacteria | 3352 |
| 67 | Ga0466703_138451 | 3300042636 | Bacteria | 17345 |
| 68 | Ga0466703_369946 | 3300042636 | Unclassified | 9236 |
| 69 | Ga0466712_040816 | 3300042614 | Bacteria | 8847 |
| 70 | Ga0466711_260410 | 3300042615 | Bacteria | 34066 |
| 71 | Ga0466715_391182 | 3300042616 | Bacteria | 13717 |
| 72 | Ga0466718_027854 | 3300042617 | Unclassified | 4760 |
| 73 | Ga0466723_094216 | 3300042618 | Bacteria | 4903 |
| 74 | Ga0466729_011572 | 3300042621 | Unclassified | 2808 |
| 75 | Ga0466705_113382 | 3300042612 | Bacteria | 4653 |
| 76 | Ga0466705_129789 | 3300042612 | Unclassified | 2662 |
| 77 | Ga0466705_337045 | 3300042612 | Bacteria | 7646 |
| 78 | Ga0466732_387525 | 3300042656 | Bacteria | 6426 |
| 79 | AustNasuHG_c1000218 | 3300000089 | Bacteria | 19111 |
| 80 | JGI24698J34947_10017257 | 3300002449 | Bacteria | 3914 |
| 81 | JGI24696J40584_12946710 | 3300002834 | Bacteria | 1912 |
| 82 | Ga0264413_117696 | 3300024493 | Bacteria | 19637 |
| 83 | Ga0466692_018301 | 3300042591 | Bacteria | 2829 |
| 84 | Ga0466693_049301 | 3300042592 | Bacteria | 70349 |
| 85 | Ga0466691_135382 | 3300042593 | Bacteria | 8694 |
| 86 | Ga0466696_206551 | 3300042596 | Bacteria | 11152 |
| 87 | Ga0123357_10148856 | 3300009784 | Bacteria | 2849 |
| 88 | Ga0123353_10091239 | 3300010167 | Bacteria | 4907 |
| 89 | Ga0466719_086676 | 3300042606 | Bacteria | 7760 |
| 90 | Ga0466720_131528 | 3300042607 | Bacteria | 5010 |
| 91 | Ga0466722_205745 | 3300042609 | Bacteria | 3363 |
| 92 | Ga0466703_007865 | 3300042636 | Bacteria | 16229 |
| 93 | Ga0466703_345013 | 3300042636 | Unclassified | 2143 |
| 94 | Ga0466704_072186 | 3300042643 | Bacteria | 11896 |
| 95 | Ga0466704_108038 | 3300042643 | Bacteria | 18603 |
| 96 | Ga0466709_066227 | 3300042648 | Bacteria | 30258 |
| 97 | Ga0466727_187194 | 3300042655 | Bacteria | 5520 |
| 98 | Ga0466705_450544 | 3300042612 | Bacteria | 5072 |
| 99 | Ga0466712_157544 | 3300042614 | Bacteria | 14024 |
| 100 | Ga0466711_083093 | 3300042615 | Bacteria | 1259 |
| 101 | Ga0466711_242096 | 3300042615 | Bacteria | 13657 |
| 102 | Ga0466715_087124 | 3300042616 | Bacteria | 2714 |
| 103 | Ga0466723_008665 | 3300042618 | Archaea | 2286 |
| 104 | Ga0466726_058348 | 3300042619 | Bacteria | 1289 |
| 105 | Ga0466726_160795 | 3300042619 | Bacteria | 1227 |
| 106 | Ga0466726_398922 | 3300042619 | Bacteria | 5390 |
| 107 | Ga0466728_066494 | 3300042620 | Bacteria | 3804 |
| 108 | Ga0466728_249690 | 3300042620 | Bacteria | 21893 |
| 109 | Ga0466732_136673 | 3300042656 | Bacteria | 2261 |
| 110 | JGI24702J35022_10013025 | 3300002462 | Bacteria | 4612 |
| 111 | Ga0456237_0001112 | 3300041968 | Bacteria | 4255 |
| 112 | Ga0466690_113559 | 3300042590 | Bacteria | 2551 |
| 113 | Ga0466691_117011 | 3300042593 | Bacteria | 6556 |
| 114 | Ga0466691_133604 | 3300042593 | Bacteria | 19141 |
| 115 | Ga0466699_042905 | 3300042597 | Bacteria | 10075 |
| 116 | Ga0466699_088974 | 3300042597 | Bacteria | 3415 |
| 117 | Ga0123353_10395165 | 3300010167 | Bacteria | 2060 |
| 118 | Ga0466707_038957 | 3300042601 | Bacteria | 1029 |
| 119 | Ga0466707_044205 | 3300042601 | Unclassified | 3122 |
| 120 | Ga0466707_097333 | 3300042601 | Bacteria | 1590 |
| 121 | Ga0466716_115402 | 3300042605 | Unclassified | 1034 |
| 122 | Ga0466719_222059 | 3300042606 | Bacteria | 10881 |
| 123 | Ga0466722_132549 | 3300042609 | Bacteria | 3651 |
| 124 | Ga0466722_137114 | 3300042609 | Bacteria | 5509 |
| 125 | Ga0466722_169808 | 3300042609 | Bacteria | 2274 |
| 126 | Ga0466722_213173 | 3300042609 | Bacteria | 10029 |
| 127 | Ga0466722_222655 | 3300042609 | Bacteria | 8321 |
| 128 | Ga0466722_223251 | 3300042609 | Bacteria | 1491 |
| 129 | Ga0466703_303231 | 3300042636 | Bacteria | 2453 |
| 130 | Ga0466703_361363 | 3300042636 | Bacteria | 3543 |
| 131 | Ga0466704_037742 | 3300042643 | Bacteria | 13459 |
| 132 | Ga0466704_231866 | 3300042643 | Bacteria | 63702 |
| 133 | Ga0466709_081055 | 3300042648 | Bacteria | 1100 |
| 134 | Ga0466709_234491 | 3300042648 | Bacteria | 16960 |
| 135 | Ga0466709_300511 | 3300042648 | Bacteria | 2565 |
| 136 | Ga0466724_20897 | 3300042649 | Bacteria | 1658 |
| 137 | Ga0466708_279997 | 3300042652 | Bacteria | 9401 |
| 138 | Ga0466711_012355 | 3300042615 | Bacteria | 12620 |
| 139 | Ga0466715_191898 | 3300042616 | Bacteria | 1803 |
| 140 | Ga0466715_213975 | 3300042616 | Bacteria | 22156 |
| 141 | Ga0466715_451531 | 3300042616 | Bacteria | 18226 |
| 142 | Ga0466718_050558 | 3300042617 | Bacteria | 40017 |
| 143 | Ga0466718_099495 | 3300042617 | Bacteria | 1278 |
| 144 | Ga0466723_056206 | 3300042618 | Bacteria | 6896 |
| 145 | Ga0466723_207293 | 3300042618 | Unclassified | 3677 |
| 146 | Ga0466728_389365 | 3300042620 | Bacteria | 2361 |
| 147 | Ga0466705_190332 | 3300042612 | Bacteria | 4043 |
| 148 | JGI24696J40584_12471149 | 3300002834 | Bacteria | 585 |
| 149 | Ga0466690_249235 | 3300042590 | Bacteria | 2490 |
| 150 | Ga0466692_187700 | 3300042591 | Bacteria | 2463 |
| 151 | Ga0466696_075468 | 3300042596 | Bacteria | 23233 |
| 152 | Ga0466707_127711 | 3300042601 | Bacteria | 1372 |
| 153 | Ga0466707_366215 | 3300042601 | Unclassified | 1527 |
| 154 | Ga0466707_387082 | 3300042601 | Unclassified | 1252 |
| 155 | Ga0466707_387149 | 3300042601 | Unclassified | 2401 |
| 156 | Ga0466735_123388 | 3300042624 | Bacteria | 3483 |
| 157 | Ga0466735_182209 | 3300042624 | Bacteria | 1494 |
| 158 | Ga0466709_068929 | 3300042648 | Bacteria | 5375 |
| 159 | Ga0466708_055061 | 3300042652 | Bacteria | 9595 |
| 160 | Ga0466711_472284 | 3300042615 | Bacteria | 6921 |
| 161 | Ga0466715_042670 | 3300042616 | Bacteria | 29859 |
| 162 | Ga0466718_021263 | 3300042617 | Bacteria | 24146 |
| 163 | Ga0466718_069328 | 3300042617 | Bacteria | 45967 |
| 164 | Ga0466718_090131 | 3300042617 | Bacteria | 2477 |
| 165 | Ga0466723_055955 | 3300042618 | Bacteria | 14111 |
| 166 | Ga0466728_083465 | 3300042620 | Bacteria | 6232 |
| 167 | Ga0466728_089482 | 3300042620 | Bacteria | 8023 |
| 168 | Ga0466705_040075 | 3300042612 | Bacteria | 3322 |
| 169 | JGI24698J34947_10011320 | 3300002449 | Unclassified | 4896 |
| 170 | JGI24698J34947_10184077 | 3300002449 | Bacteria | 832 |
| 171 | JGI24705J35276_11918920 | 3300002504 | Unclassified | 766 |
| 172 | Ga0072940_1002370 | 3300005200 | Bacteria | 17923 |
| 173 | Ga0466690_081376 | 3300042590 | Bacteria | 5143 |
| 174 | Ga0466692_029194 | 3300042591 | Bacteria | 54799 |
| 175 | Ga0466694_244817 | 3300042594 | Bacteria | 21258 |
| 176 | Ga0466696_108755 | 3300042596 | Bacteria | 15910 |
| 177 | Ga0466699_057456 | 3300042597 | Bacteria | 12121 |
| 178 | Ga0466716_260633 | 3300042605 | Bacteria | 7818 |
| 179 | Ga0466719_315747 | 3300042606 | Bacteria | 10774 |
| 180 | Ga0466720_122615 | 3300042607 | Bacteria | 7521 |
| 181 | Ga0466703_040842 | 3300042636 | Bacteria | 2825 |
| 182 | Ga0466703_072240 | 3300042636 | Bacteria | 3142 |
| 183 | Ga0466703_100296 | 3300042636 | Bacteria | 9604 |
| 184 | Ga0466703_106290 | 3300042636 | Bacteria | 10338 |
| 185 | Ga0466709_168954 | 3300042648 | Bacteria | 1895 |
| 186 | Ga0466709_326521 | 3300042648 | Bacteria | 4821 |
| 187 | Ga0466708_100036 | 3300042652 | Bacteria | 7295 |
| 188 | Ga0466708_123569 | 3300042652 | Bacteria | 3856 |
| 189 | Ga0466727_140522 | 3300042655 | Unclassified | 4140 |
| 190 | Ga0466727_164241 | 3300042655 | Bacteria | 1818 |
| 191 | Ga0466715_102574 | 3300042616 | Bacteria | 10967 |
| 192 | Ga0466705_147090 | 3300042612 | Unclassified | 9452 |
| 193 | Ga0466705_247293 | 3300042612 | Bacteria | 5926 |
| 194 | Ga0466705_254773 | 3300042612 | Bacteria | 11532 |
| 195 | JGI24698J34947_10041516 | 3300002449 | Unclassified | 2369 |
| 196 | JGI24695J34938_10006871 | 3300002450 | Bacteria | 6756 |
| 197 | JGI24695J34938_10072940 | 3300002450 | Bacteria | 1431 |
| 198 | Ga0466691_164812 | 3300042593 | Bacteria | 5065 |
| 199 | Ga0466696_013107 | 3300042596 | Bacteria | 16257 |
| 200 | Ga0466696_023575 | 3300042596 | Bacteria | 2672 |
| 201 | Ga0123353_10417738 | 3300010167 | Bacteria | 1989 |
| 202 | Ga0123353_10805824 | 3300010167 | Bacteria | 1296 |
| 203 | Ga0466706_283442 | 3300042599 | Bacteria | 1234 |
| 204 | Ga0466707_059528 | 3300042601 | Bacteria | 7426 |
| 205 | Ga0466719_260620 | 3300042606 | Bacteria | 3442 |
| 206 | Ga0466719_345992 | 3300042606 | Bacteria | 9283 |
| 207 | Ga0466720_081200 | 3300042607 | Unclassified | 1672 |
| 208 | Ga0466722_040792 | 3300042609 | Bacteria | 3561 |
| 209 | Ga0466731_101559 | 3300042622 | Bacteria | 3227 |
| 210 | Ga0466703_230159 | 3300042636 | Bacteria | 17794 |
| 211 | Ga0466709_242649 | 3300042648 | Bacteria | 3734 |
| 212 | Ga0466709_277292 | 3300042648 | Unclassified | 2313 |
| 213 | Ga0466708_000812 | 3300042652 | Unclassified | 2056 |
| 214 | Ga0466708_264944 | 3300042652 | Bacteria | 11542 |
| 215 | Ga0466708_417110 | 3300042652 | Unclassified | 5357 |
| 216 | Ga0466727_163465 | 3300042655 | Bacteria | 2402 |
| 217 | Ga0466711_226849 | 3300042615 | Bacteria | 4469 |
| 218 | Ga0466711_350362 | 3300042615 | Bacteria | 1901 |
| 219 | Ga0466711_505705 | 3300042615 | Bacteria | 6522 |
| 220 | Ga0466718_003181 | 3300042617 | Bacteria | 2813 |
| 221 | Ga0466726_472439 | 3300042619 | Bacteria | 11762 |
| 222 | Ga0466729_025390 | 3300042621 | Bacteria | 1227 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01783 | Ribosomal_L32p | Ribosomal L32p protein family | 2 | 56 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.