Protein Family IF09911
Metagenome
Isolate
109
Members
44
Samples
105
Scaffolds
171.96
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_155912|Ga0466708_155912_13188_13799
- Length
- 203 aa
- Sequence
- LSLKKIAKRNLQKNFCERLQKIGGVFVSMDIIWAPWRMAYIDGVDVEPERVEVGEGADADCFICQSVFDKSHDRERFVVCRTELTVTMLNKFPYNNGHLLIAPCIHTGNLGELCEAVQLQILREIDRWVKTLEYLMKPDGFNIGLNLGRSAGAGLPGHLHWHIVPRWNGDTNFTTTISSTKVIPQSLNALWETLNATVNNRKN
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.5%
Kalotermitidae
30.2%
Unclassified
9.3%
Passalidae
4.7%
Termopsidae
4.7%
Rhinotermitidae
4.7%
Taxonomy
Archaea
0
Bacteria
93
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 40 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_116754 | 3300042612 | Bacteria | 17617 |
| 2 | Ga0466703_268115 | 3300042636 | Bacteria | 4923 |
| 3 | Ga0466704_055971 | 3300042643 | Bacteria | 7331 |
| 4 | 2227569088 | 2225789004 | Unclassified | 13951 |
| 5 | Ga0068302_10252461 | 3300005071 | Bacteria | 978 |
| 6 | Ga0123357_10772189 | 3300009784 | Unclassified | 660 |
| 7 | Ga0123356_10267095 | 3300010049 | Bacteria | 1798 |
| 8 | Ga0123353_10073937 | 3300010167 | Bacteria | 5479 |
| 9 | Ga0123353_10531911 | 3300010167 | Bacteria | 1702 |
| 10 | Ga0466690_258373 | 3300042590 | Unclassified | 1600 |
| 11 | Ga0466700_156305 | 3300042600 | Bacteria | 2044 |
| 12 | Ga0466716_137017 | 3300042605 | Bacteria | 10039 |
| 13 | Ga0466711_011304 | 3300042615 | Bacteria | 2520 |
| 14 | Ga0466711_150433 | 3300042615 | Bacteria | 22953 |
| 15 | Ga0466715_091065 | 3300042616 | Bacteria | 2003 |
| 16 | Ga0466715_156350 | 3300042616 | Bacteria | 120435 |
| 17 | Ga0466705_222448 | 3300042612 | Bacteria | 3003 |
| 18 | Ga0466733_142955 | 3300042659 | Bacteria | 1549 |
| 19 | Ga0466734_003373 | 3300042623 | Bacteria | 3291 |
| 20 | Ga0466703_290168 | 3300042636 | Bacteria | 5828 |
| 21 | Ga0466708_411728 | 3300042652 | Bacteria | 1809 |
| 22 | 2227183314 | 2225789004 | Bacteria | 1487 |
| 23 | Ga0072940_1188471 | 3300005200 | Bacteria | 2306 |
| 24 | Ga0123356_10416405 | 3300010049 | Unclassified | 1485 |
| 25 | Ga0123354_10794952 | 3300010882 | Unclassified | 639 |
| 26 | Ga0466696_198617 | 3300042596 | Bacteria | 4072 |
| 27 | Ga0466717_111074 | 3300042604 | Bacteria | 2114 |
| 28 | Ga0466717_139502 | 3300042604 | Bacteria | 11559 |
| 29 | Ga0466716_475325 | 3300042605 | Bacteria | 1892 |
| 30 | Ga0466698_045529 | 3300042610 | Unclassified | 2707 |
| 31 | Ga0466728_030465 | 3300042620 | Bacteria | 8865 |
| 32 | Ga0466729_007173 | 3300042621 | Bacteria | 8965 |
| 33 | JGI24702J35022_10235757 | 3300002462 | Unclassified | 1060 |
| 34 | Ga0074263_100188 | 3300005485 | Bacteria | 1403 |
| 35 | Ga0123353_10011480 | 3300010167 | Bacteria | 12483 |
| 36 | Ga0123353_10030670 | 3300010167 | Unclassified | 8313 |
| 37 | Ga0123353_11093624 | 3300010167 | Bacteria | 1059 |
| 38 | Ga0123353_11243919 | 3300010167 | Bacteria | 972 |
| 39 | Ga0466695_226615 | 3300042595 | Bacteria | 8149 |
| 40 | Ga0466699_113307 | 3300042597 | Bacteria | 2730 |
| 41 | Ga0466707_376196 | 3300042601 | Bacteria | 7386 |
| 42 | Ga0466707_382606 | 3300042601 | Bacteria | 1534 |
| 43 | Ga0466717_094918 | 3300042604 | Bacteria | 3265 |
| 44 | Ga0466723_302118 | 3300042618 | Bacteria | 50373 |
| 45 | Ga0466733_157210 | 3300042659 | Bacteria | 3495 |
| 46 | Ga0466708_155912 | 3300042652 | Bacteria | 16563 |
| 47 | Ga0123355_10467295 | 3300009826 | Unclassified | 1579 |
| 48 | Ga0123356_10174617 | 3300010049 | Bacteria | 2164 |
| 49 | Ga0123356_11966940 | 3300010049 | Unclassified | 729 |
| 50 | Ga0123353_10310292 | 3300010167 | Bacteria | 2401 |
| 51 | Ga0123353_11264005 | 3300010167 | Unclassified | 962 |
| 52 | Ga0466693_251180 | 3300042592 | Bacteria | 1033 |
| 53 | Ga0466700_210464 | 3300042600 | Bacteria | 1058 |
| 54 | Ga0466715_027682 | 3300042616 | Bacteria | 2700 |
| 55 | Ga0466729_275477 | 3300042621 | Bacteria | 2742 |
| 56 | Ga0466703_233530 | 3300042636 | Bacteria | 3636 |
| 57 | Ga0466704_217528 | 3300042643 | Bacteria | 3432 |
| 58 | 2227667399 | 2225789004 | Bacteria | 1916 |
| 59 | JGI24698J34947_10080757 | 3300002449 | Bacteria | 1526 |
| 60 | JGI24702J35022_10430376 | 3300002462 | Unclassified | 801 |
| 61 | Ga0123356_10860086 | 3300010049 | Unclassified | 1078 |
| 62 | Ga0123353_10212124 | 3300010167 | Bacteria | 3036 |
| 63 | Ga0466690_222635 | 3300042590 | Bacteria | 1854 |
| 64 | Ga0466695_176004 | 3300042595 | Bacteria | 1325 |
| 65 | Ga0466700_234014 | 3300042600 | Bacteria | 3743 |
| 66 | Ga0466707_353343 | 3300042601 | Bacteria | 2762 |
| 67 | Ga0466717_093723 | 3300042604 | Bacteria | 3915 |
| 68 | Ga0466703_060562 | 3300042636 | Bacteria | 11792 |
| 69 | Ga0466703_165863 | 3300042636 | Bacteria | 1195 |
| 70 | IMNBL1DRAFT_c0012336 | 3300000062 | Bacteria | 3915 |
| 71 | JGI24695J34938_10039635 | 3300002450 | Bacteria | 2126 |
| 72 | JGI24702J35022_10032606 | 3300002462 | Bacteria | 2789 |
| 73 | Ga0123355_10521464 | 3300009826 | Bacteria | 1453 |
| 74 | Ga0123353_10082336 | 3300010167 | Bacteria | 5176 |
| 75 | Ga0264413_140177 | 3300024493 | Bacteria | 3915 |
| 76 | Ga0466693_200132 | 3300042592 | Bacteria | 2039 |
| 77 | Ga0466696_283771 | 3300042596 | Bacteria | 1996 |
| 78 | Ga0466707_397653 | 3300042601 | Bacteria | 1032 |
| 79 | Ga0466711_052516 | 3300042615 | Bacteria | 8083 |
| 80 | Ga0466711_492981 | 3300042615 | Bacteria | 2364 |
| 81 | Ga0466726_003727 | 3300042619 | Bacteria | 23937 |
| 82 | Ga0466729_190696 | 3300042621 | Bacteria | 5919 |
| 83 | Ga0466732_366390 | 3300042656 | Bacteria | 11237 |
| 84 | Ga0466704_038483 | 3300042643 | Bacteria | 1696 |
| 85 | Ga0466704_061850 | 3300042643 | Bacteria | 8275 |
| 86 | Ga0072940_1040535 | 3300005200 | Bacteria | 2738 |
| 87 | Ga0123353_11285628 | 3300010167 | Bacteria | 951 |
| 88 | Ga0466695_364721 | 3300042595 | Bacteria | 1329 |
| 89 | Ga0466707_249344 | 3300042601 | Bacteria | 46944 |
| 90 | Ga0466729_061912 | 3300042621 | Bacteria | 5462 |
| 91 | Ga0466734_040825 | 3300042623 | Bacteria | 1613 |
| 92 | Ga0466703_242803 | 3300042636 | Bacteria | 16922 |
| 93 | JGI24698J34947_10006414 | 3300002449 | Bacteria | 6457 |
| 94 | Ga0123356_10391611 | 3300010049 | Bacteria | 1525 |
| 95 | Ga0123353_10005069 | 3300010167 | Bacteria | 17193 |
| 96 | Ga0123353_10173201 | 3300010167 | Bacteria | 3424 |
| 97 | Ga0123353_11298583 | 3300010167 | Unclassified | 945 |
| 98 | Ga0466691_166360 | 3300042593 | Bacteria | 3950 |
| 99 | Ga0466700_089354 | 3300042600 | Bacteria | 2401 |
| 100 | Ga0466717_040516 | 3300042604 | Bacteria | 1070 |
| 101 | Ga0466719_093095 | 3300042606 | Unclassified | 1572 |
| 102 | Ga0466719_460305 | 3300042606 | Bacteria | 2264 |
| 103 | Ga0466719_572949 | 3300042606 | Unclassified | 14072 |
| 104 | Ga0466712_199482 | 3300042614 | Bacteria | 1908 |
| 105 | Ga0466723_030348 | 3300042618 | Bacteria | 7659 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01230 | HIT | HIT domain | 75 | 166 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01230 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.