Protein Family IF09879
Metagenome
Isolate
196
Members
153
Samples
96
Scaffolds
333.16
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_094135|Ga0466708_094135_3563_4723
- Length
- 386 aa
- Sequence
- MATSKTQIPTGRNPRQQTDPREEIAIRPDHPQGNCHPQGLSARIVVTSGEPAGVGPELCLRLAHVDCGARLIVLADRDLLAKRARLLRVPIALRDYQPDAPLPPPGALEVRHHPLSAPSAPGKLNAANSAYVIRLLDDAIDGCLSGEFAAMITAPIHKGVINEAKIFGGATFTGHTEYLAERAHAPKVVMMLAGETPQGHADGQLRVALATTHLPLKAVAAAITPESLASILRILHRELRAKYGLAAPRILVSGLNPHAGEGGHLGREEIDIIIPTLEKLRNEGMTLIGPLPADTLFTPPMLAQGDAVLAMHHDQGLAPLKYATFGKGVNITLGLPFIRTSVDHGTALDLAGSGKANPGSLLAALREAARMRQQTTANNTPLTPET
Sample Types
Isolate
51.0%
Metagenome
49.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
41.8%
Unclassified
19.6%
Termitidae
11.1%
Kalotermitidae
8.5%
Formicidae
5.9%
Elmidae
3.9%
Rhinotermitidae
3.3%
Psyllidae
1.3%
Aphididae
1.3%
Hodotermitidae
0.7%
Termopsidae
0.7%
Culicidae
0.7%
Curculionidae
0.7%
Trigoniulidae
0.7%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 3 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 4 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 5 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 6 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 7 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 8 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 14 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 15 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 20 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 21 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 22 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 23 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 24 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 25 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 26 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 27 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 28 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 29 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 30 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 31 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 32 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 33 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 34 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 37 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 38 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 39 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 40 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 41 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 42 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 43 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 44 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 45 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 46 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 47 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 55 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 56 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 57 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 58 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 59 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 60 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 61 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 62 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 65 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 66 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 70 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 71 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 72 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 73 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 74 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 75 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 76 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 77 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 78 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 79 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 80 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 81 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 82 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 83 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 87 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 88 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 89 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 90 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 91 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 92 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 93 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 94 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 95 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 96 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 97 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 98 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 99 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 100 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 101 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 102 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 103 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 104 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 105 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 106 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 107 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 108 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 109 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 110 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 111 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 112 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 113 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 114 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 115 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 116 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 117 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 118 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 119 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 120 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 121 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 122 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 123 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 124 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 125 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 126 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 127 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 128 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 129 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 130 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 131 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 132 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 133 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 134 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 135 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 136 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 137 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 138 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 139 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 140 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 141 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 142 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 143 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 144 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 145 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 146 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 147 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 148 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 149 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 150 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 151 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 152 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 153 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_052474 | 3300042656 | Bacteria | 1706 |
| 2 | Ga0466709_135032 | 3300042648 | Bacteria | 6812 |
| 3 | Ga0466708_199948 | 3300042652 | Bacteria | 19732 |
| 4 | Ga0466725_122565 | 3300042654 | Bacteria | 38170 |
| 5 | Ga0466719_306833 | 3300042606 | Bacteria | 15322 |
| 6 | Ga0466719_375698 | 3300042606 | Bacteria | 6447 |
| 7 | Ga0466722_060071 | 3300042609 | Bacteria | 4240 |
| 8 | Ga0466705_021937 | 3300042612 | Bacteria | 75613 |
| 9 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 10 | Ga0466708_335652 | 3300042652 | Bacteria | 8849 |
| 11 | Ga0466725_423449 | 3300042654 | Bacteria | 15695 |
| 12 | Ga0466657_134450 | 3300042582 | Bacteria | 78347 |
| 13 | Ga0466657_380616 | 3300042582 | Bacteria | 14446 |
| 14 | Ga0466690_049466 | 3300042590 | Bacteria | 16931 |
| 15 | Ga0466692_053225 | 3300042591 | Bacteria | 32811 |
| 16 | SCG598O11_12592 | 3300000471 | Bacteria | 74107 |
| 17 | Ga0103261_1007718 | 3300007083 | Unclassified | 2143 |
| 18 | Ga0103268_1000214 | 3300007192 | Bacteria | 19061 |
| 19 | Ga0466723_211946 | 3300042618 | Bacteria | 6394 |
| 20 | Ga0466733_196082 | 3300042659 | Bacteria | 37545 |
| 21 | Ga0466704_476013 | 3300042643 | Bacteria | 17864 |
| 22 | Ga0466725_028174 | 3300042654 | Bacteria | 52146 |
| 23 | Ga0466657_120201 | 3300042582 | Bacteria | 13360 |
| 24 | Ga0123353_10078388 | 3300010167 | Bacteria | 5309 |
| 25 | Ga0123353_10525800 | 3300010167 | Bacteria | 1715 |
| 26 | JGI24702J35022_10117810 | 3300002462 | Unclassified | 1465 |
| 27 | CVPL005W_1000091 | 3300002934 | Bacteria | 39163 |
| 28 | Ga0102733_100970 | 3300006995 | Bacteria | 1725 |
| 29 | Ga0103264_1011955 | 3300007188 | Bacteria | 4254 |
| 30 | Ga0466711_126392 | 3300042615 | Bacteria | 29897 |
| 31 | Ga0466711_498243 | 3300042615 | Bacteria | 3544 |
| 32 | Ga0466709_073297 | 3300042648 | Bacteria | 46472 |
| 33 | Ga0466725_153172 | 3300042654 | Bacteria | 42686 |
| 34 | Ga0466725_372110 | 3300042654 | Bacteria | 16796 |
| 35 | Ga0466695_193039 | 3300042595 | Bacteria | 3783 |
| 36 | Ga0466707_275452 | 3300042601 | Bacteria | 60681 |
| 37 | Ga0466713_058545 | 3300042602 | Bacteria | 16793 |
| 38 | Ga0466719_562397 | 3300042606 | Bacteria | 1472 |
| 39 | Ga0123354_10179805 | 3300010882 | Bacteria | 2420 |
| 40 | JGI24702J35022_10001573 | 3300002462 | Bacteria | 14156 |
| 41 | JGI24702J35022_10007934 | 3300002462 | Bacteria | 6044 |
| 42 | Ga0466710_216779 | 3300042613 | Bacteria | 69189 |
| 43 | Ga0466728_216155 | 3300042620 | Bacteria | 24645 |
| 44 | Ga0466729_015681 | 3300042621 | Bacteria | 43972 |
| 45 | Ga0466734_049940 | 3300042623 | Bacteria | 7382 |
| 46 | Ga0466708_073315 | 3300042652 | Bacteria | 8442 |
| 47 | Ga0466708_294395 | 3300042652 | Bacteria | 9591 |
| 48 | Ga0466725_107518 | 3300042654 | Bacteria | 74412 |
| 49 | Ga0466727_348085 | 3300042655 | Bacteria | 55364 |
| 50 | Ga0466690_371988 | 3300042590 | Bacteria | 9662 |
| 51 | Ga0466692_007609 | 3300042591 | Bacteria | 13735 |
| 52 | Ga0466706_224306 | 3300042599 | Bacteria | 3418 |
| 53 | JGI24705J35276_12236652 | 3300002504 | Bacteria | 8528 |
| 54 | Ga0102737_1001457 | 3300007142 | Bacteria | 6575 |
| 55 | Ga0103264_1000303 | 3300007188 | Bacteria | 27740 |
| 56 | Ga0466710_169048 | 3300042613 | Bacteria | 56427 |
| 57 | Ga0466734_055400 | 3300042623 | Bacteria | 6598 |
| 58 | Ga0466657_021393 | 3300042582 | Bacteria | 15204 |
| 59 | Ga0466657_147547 | 3300042582 | Bacteria | 109165 |
| 60 | Ga0466657_219361 | 3300042582 | Bacteria | 9751 |
| 61 | Ga0466690_027779 | 3300042590 | Bacteria | 32483 |
| 62 | Ga0466691_133558 | 3300042593 | Bacteria | 11348 |
| 63 | Ga0466701_036719 | 3300042598 | Bacteria | 2009 |
| 64 | Ga0466700_236584 | 3300042600 | Bacteria | 2209 |
| 65 | Ga0466716_144297 | 3300042605 | Bacteria | 2473 |
| 66 | Ga0123355_10400675 | 3300009826 | Bacteria | 1770 |
| 67 | Ga0123353_10000085 | 3300010167 | Bacteria | 104811 |
| 68 | Ga0063521_1000412 | 3300003973 | Bacteria | 23270 |
| 69 | Ga0123357_10000032 | 3300009784 | Bacteria | 114773 |
| 70 | Ga0123357_10001149 | 3300009784 | Bacteria | 27533 |
| 71 | Ga0466723_085288 | 3300042618 | Bacteria | 19429 |
| 72 | Ga0466729_266514 | 3300042621 | Bacteria | 5182 |
| 73 | Ga0466717_082546 | 3300042604 | Bacteria | 5940 |
| 74 | Ga0466719_234997 | 3300042606 | Bacteria | 6772 |
| 75 | Ga0466719_453974 | 3300042606 | Bacteria | 1426 |
| 76 | Ga0123357_10019762 | 3300009784 | Unclassified | 8988 |
| 77 | Ga0123356_10011060 | 3300010049 | Bacteria | 8813 |
| 78 | HBC_ctgsDRAFT_1034379 | 3300000333 | Unclassified | 1245 |
| 79 | Ga0074278_143314 | 3300005721 | Unclassified | 4747 |
| 80 | Ga0102739_1000299 | 3300007095 | Bacteria | 11327 |
| 81 | Ga0127530_195982 | 3300009468 | Bacteria | 2302 |
| 82 | Ga0466705_419657 | 3300042612 | Bacteria | 9874 |
| 83 | Ga0466715_216658 | 3300042616 | Bacteria | 3256 |
| 84 | Ga0466729_298879 | 3300042621 | Bacteria | 94207 |
| 85 | Ga0466734_074459 | 3300042623 | Bacteria | 6336 |
| 86 | Ga0466703_174532 | 3300042636 | Bacteria | 30809 |
| 87 | Ga0466703_429090 | 3300042636 | Bacteria | 23816 |
| 88 | Ga0466704_363902 | 3300042643 | Bacteria | 140929 |
| 89 | Ga0466708_094135 | 3300042652 | Bacteria | 19958 |
| 90 | Ga0160448_100106 | 3300012854 | Bacteria | 41681 |
| 91 | Ga0466691_056263 | 3300042593 | Bacteria | 5608 |
| 92 | Ga0466707_129562 | 3300042601 | Bacteria | 78697 |
| 93 | Ga0123356_10257090 | 3300010049 | Bacteria | 1828 |
| 94 | Ga0068305_10185784 | 3300005083 | Bacteria | 3848 |
| 95 | Ga0103266_1000055 | 3300007067 | Bacteria | 76804 |
| 96 | Ga0103267_1000413 | 3300007190 | Bacteria | 23039 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04166 | PdxA | Pyridoxal phosphate biosynthetic protein PdxA | 70 | 368 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04166 | GO:0051287 | NAD binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.