Protein Family IF09855
Metagenome
Isolate
148
Members
40
Samples
144
Scaffolds
360.82
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_062803|Ga0466708_062803_377_1615
- Length
- 412 aa
- Sequence
- MIGKIPYNNNMASFDVSKRWIILSPASIPVAGQAAAELADCISLLRGRAGLGKASPVIENAETVSPPDSEPVILLNSGGAGPDRNGYTWRLGRGRLEIYGDSGRGLCSGVFDFLSALGISWPKPGLELFPPPAPGAAVSAATGCYPLADDRAICPSAGSPAELRRLVINEKAKLKDPESIVRWAARNRCDSLVLSFGGKLLRDAAFSGAVKKYAMMIEAGGWDLSLLLPRSLFFLHRELFRMEGGRRTPRHNFCPTNPETMEFLQKNAARLFSRAIPLMSGEPAEGPAASGGGTGGARPVRVFHLWPDRGHEKSWCSCPACRAFTPEDQNRIALNIAADALARIDPNARLGFYEAPGDGRAESGAGGASDEDGADRGEGAAPAGGIRTRPNLFILNRYPECVPKQRACPASR
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
25.6%
Unclassified
17.9%
Rhinotermitidae
10.3%
Termopsidae
7.7%
Hodotermitidae
2.6%
Taxonomy
Archaea
1
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 2 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 5 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 33 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10050361 | 3300010882 | Bacteria | 6305 |
| 2 | Ga0466711_369834 | 3300042615 | Bacteria | 16904 |
| 3 | Ga0466715_118026 | 3300042616 | Bacteria | 1457 |
| 4 | Ga0466723_155571 | 3300042618 | Bacteria | 25504 |
| 5 | Ga0466723_271089 | 3300042618 | Bacteria | 5326 |
| 6 | Ga0466726_023856 | 3300042619 | Bacteria | 3185 |
| 7 | Ga0466728_206814 | 3300042620 | Unclassified | 1621 |
| 8 | Ga0466716_047906 | 3300042605 | Bacteria | 5281 |
| 9 | Ga0466719_012909 | 3300042606 | Bacteria | 11835 |
| 10 | Ga0466722_021973 | 3300042609 | Bacteria | 8920 |
| 11 | Ga0466722_036150 | 3300042609 | Bacteria | 7614 |
| 12 | Ga0466722_063122 | 3300042609 | Bacteria | 2259 |
| 13 | Ga0466704_156708 | 3300042643 | Bacteria | 46271 |
| 14 | Ga0466704_231297 | 3300042643 | Bacteria | 4195 |
| 15 | Ga0466709_101221 | 3300042648 | Bacteria | 4996 |
| 16 | Ga0466691_146718 | 3300042593 | Unclassified | 3053 |
| 17 | Ga0466694_243567 | 3300042594 | Bacteria | 14574 |
| 18 | Ga0466696_088771 | 3300042596 | Bacteria | 12672 |
| 19 | Ga0466705_009050 | 3300042612 | Bacteria | 20742 |
| 20 | AustNasuHG_c1000223 | 3300000089 | Bacteria | 18892 |
| 21 | Ga0123357_10021593 | 3300009784 | Bacteria | 8617 |
| 22 | Ga0466711_042312 | 3300042615 | Bacteria | 1260 |
| 23 | Ga0466715_125173 | 3300042616 | Bacteria | 7120 |
| 24 | Ga0466718_168315 | 3300042617 | Bacteria | 2270 |
| 25 | Ga0466723_158436 | 3300042618 | Bacteria | 3398 |
| 26 | Ga0466728_472848 | 3300042620 | Bacteria | 4606 |
| 27 | Ga0466707_313042 | 3300042601 | Bacteria | 3512 |
| 28 | Ga0466720_112100 | 3300042607 | Bacteria | 2650 |
| 29 | Ga0466722_063984 | 3300042609 | Bacteria | 16598 |
| 30 | Ga0466703_084955 | 3300042636 | Bacteria | 22090 |
| 31 | Ga0466703_282492 | 3300042636 | Bacteria | 3849 |
| 32 | Ga0466703_339859 | 3300042636 | Bacteria | 3709 |
| 33 | Ga0466704_078633 | 3300042643 | Unclassified | 1480 |
| 34 | Ga0466704_201723 | 3300042643 | Bacteria | 8038 |
| 35 | Ga0466709_267872 | 3300042648 | Bacteria | 11236 |
| 36 | Ga0466709_283064 | 3300042648 | Bacteria | 1124 |
| 37 | Ga0466690_322180 | 3300042590 | Bacteria | 26244 |
| 38 | Ga0466691_030534 | 3300042593 | Bacteria | 19971 |
| 39 | Ga0466705_255562 | 3300042612 | Bacteria | 10524 |
| 40 | Ga0466732_254334 | 3300042656 | Bacteria | 4963 |
| 41 | JGI24698J34947_10002668 | 3300002449 | Unclassified | 9621 |
| 42 | JGI24698J34947_10013083 | 3300002449 | Bacteria | 4533 |
| 43 | Ga0466711_468508 | 3300042615 | Bacteria | 2778 |
| 44 | Ga0466715_037932 | 3300042616 | Bacteria | 49289 |
| 45 | Ga0466715_352672 | 3300042616 | Bacteria | 5142 |
| 46 | Ga0466723_016280 | 3300042618 | Bacteria | 23329 |
| 47 | Ga0466726_366901 | 3300042619 | Bacteria | 26233 |
| 48 | Ga0466728_038469 | 3300042620 | Bacteria | 2414 |
| 49 | Ga0466728_135825 | 3300042620 | Bacteria | 1782 |
| 50 | Ga0466716_222822 | 3300042605 | Bacteria | 2880 |
| 51 | Ga0466719_203305 | 3300042606 | Bacteria | 2550 |
| 52 | Ga0466720_081499 | 3300042607 | Bacteria | 1462 |
| 53 | Ga0466722_113332 | 3300042609 | Bacteria | 4579 |
| 54 | Ga0466729_209497 | 3300042621 | Bacteria | 1262 |
| 55 | Ga0466703_045315 | 3300042636 | Bacteria | 27833 |
| 56 | Ga0466704_326647 | 3300042643 | Bacteria | 4531 |
| 57 | Ga0466704_542795 | 3300042643 | Bacteria | 9557 |
| 58 | Ga0466709_071710 | 3300042648 | Bacteria | 8781 |
| 59 | Ga0466709_187685 | 3300042648 | Bacteria | 10878 |
| 60 | Ga0466692_049811 | 3300042591 | Bacteria | 11858 |
| 61 | Ga0466705_043364 | 3300042612 | Bacteria | 13414 |
| 62 | Ga0466732_395862 | 3300042656 | Bacteria | 1860 |
| 63 | JGI24698J34947_10018360 | 3300002449 | Bacteria | 3781 |
| 64 | Ga0466711_235248 | 3300042615 | Bacteria | 8127 |
| 65 | Ga0466711_247166 | 3300042615 | Bacteria | 67797 |
| 66 | Ga0466726_166892 | 3300042619 | Bacteria | 4561 |
| 67 | Ga0466728_011066 | 3300042620 | Bacteria | 10869 |
| 68 | Ga0466706_161632 | 3300042599 | Bacteria | 2472 |
| 69 | Ga0466722_052609 | 3300042609 | Bacteria | 1764 |
| 70 | Ga0466703_060530 | 3300042636 | Bacteria | 3759 |
| 71 | Ga0466703_076609 | 3300042636 | Bacteria | 8212 |
| 72 | Ga0466704_162696 | 3300042643 | Bacteria | 1742 |
| 73 | Ga0466704_191820 | 3300042643 | Archaea | 2269 |
| 74 | Ga0466704_218998 | 3300042643 | Bacteria | 3479 |
| 75 | Ga0466708_062803 | 3300042652 | Bacteria | 8636 |
| 76 | Ga0466708_151570 | 3300042652 | Bacteria | 7173 |
| 77 | Ga0466708_239194 | 3300042652 | Bacteria | 17718 |
| 78 | Ga0264413_108342 | 3300024493 | Bacteria | 13404 |
| 79 | Ga0264413_141587 | 3300024493 | Bacteria | 2645 |
| 80 | Ga0466692_029809 | 3300042591 | Bacteria | 9167 |
| 81 | Ga0466705_062621 | 3300042612 | Bacteria | 3853 |
| 82 | Ga0466705_355023 | 3300042612 | Bacteria | 33559 |
| 83 | AustNasuHG_c1001144 | 3300000089 | Bacteria | 9560 |
| 84 | Ga0466711_047403 | 3300042615 | Bacteria | 11190 |
| 85 | Ga0466711_116287 | 3300042615 | Bacteria | 17193 |
| 86 | Ga0466711_159616 | 3300042615 | Bacteria | 2311 |
| 87 | Ga0466711_188598 | 3300042615 | Bacteria | 4095 |
| 88 | Ga0466711_283728 | 3300042615 | Bacteria | 2685 |
| 89 | Ga0466715_350948 | 3300042616 | Bacteria | 4844 |
| 90 | Ga0466728_160735 | 3300042620 | Bacteria | 6272 |
| 91 | Ga0466716_171021 | 3300042605 | Bacteria | 5352 |
| 92 | Ga0466719_014501 | 3300042606 | Bacteria | 38416 |
| 93 | Ga0466720_133761 | 3300042607 | Bacteria | 1519 |
| 94 | Ga0466722_040721 | 3300042609 | Bacteria | 4199 |
| 95 | Ga0466729_290251 | 3300042621 | Bacteria | 1713 |
| 96 | Ga0466735_055048 | 3300042624 | Bacteria | 2973 |
| 97 | Ga0466708_137466 | 3300042652 | Bacteria | 3976 |
| 98 | Ga0466708_154788 | 3300042652 | Bacteria | 8926 |
| 99 | Ga0456237_0006680 | 3300041968 | Unclassified | 1800 |
| 100 | Ga0466690_318118 | 3300042590 | Bacteria | 10990 |
| 101 | Ga0466692_024652 | 3300042591 | Bacteria | 1754 |
| 102 | Ga0466696_310907 | 3300042596 | Bacteria | 1416 |
| 103 | Ga0466712_191411 | 3300042614 | Bacteria | 12658 |
| 104 | Ga0466715_514480 | 3300042616 | Bacteria | 23319 |
| 105 | Ga0466723_252775 | 3300042618 | Bacteria | 4678 |
| 106 | Ga0466728_084744 | 3300042620 | Bacteria | 6408 |
| 107 | Ga0466713_044395 | 3300042602 | Bacteria | 3292 |
| 108 | Ga0466722_011880 | 3300042609 | Bacteria | 11981 |
| 109 | Ga0466727_230595 | 3300042655 | Bacteria | 1383 |
| 110 | Ga0466692_101136 | 3300042591 | Bacteria | 9849 |
| 111 | Ga0466705_073481 | 3300042612 | Bacteria | 5233 |
| 112 | Ga0123355_10053695 | 3300009826 | Bacteria | 6532 |
| 113 | Ga0466712_035254 | 3300042614 | Bacteria | 13993 |
| 114 | Ga0466712_155058 | 3300042614 | Bacteria | 14937 |
| 115 | Ga0466715_292613 | 3300042616 | Bacteria | 13843 |
| 116 | Ga0466718_145204 | 3300042617 | Bacteria | 4762 |
| 117 | Ga0466728_067611 | 3300042620 | Bacteria | 1559 |
| 118 | Ga0466722_065079 | 3300042609 | Bacteria | 5282 |
| 119 | Ga0466722_153473 | 3300042609 | Bacteria | 1351 |
| 120 | Ga0466735_159455 | 3300042624 | Bacteria | 1227 |
| 121 | Ga0466708_130911 | 3300042652 | Bacteria | 2446 |
| 122 | Ga0264413_121157 | 3300024493 | Bacteria | 6524 |
| 123 | Ga0466696_320320 | 3300042596 | Bacteria | 5744 |
| 124 | Ga0466705_089436 | 3300042612 | Bacteria | 5595 |
| 125 | Ga0068305_10059939 | 3300005083 | Bacteria | 28529 |
| 126 | Ga0466711_304839 | 3300042615 | Bacteria | 5554 |
| 127 | Ga0466715_537521 | 3300042616 | Bacteria | 3569 |
| 128 | Ga0466715_610040 | 3300042616 | Bacteria | 1851 |
| 129 | Ga0466718_048360 | 3300042617 | Bacteria | 6493 |
| 130 | Ga0466723_203080 | 3300042618 | Bacteria | 9115 |
| 131 | Ga0466726_108656 | 3300042619 | Bacteria | 4471 |
| 132 | Ga0466716_191811 | 3300042605 | Bacteria | 3643 |
| 133 | Ga0466722_135112 | 3300042609 | Bacteria | 11482 |
| 134 | Ga0466722_210869 | 3300042609 | Bacteria | 4673 |
| 135 | Ga0466735_085109 | 3300042624 | Bacteria | 2877 |
| 136 | Ga0466703_053299 | 3300042636 | Bacteria | 7022 |
| 137 | Ga0466703_308190 | 3300042636 | Bacteria | 1769 |
| 138 | Ga0466704_444030 | 3300042643 | Bacteria | 7902 |
| 139 | Ga0466708_024574 | 3300042652 | Bacteria | 3179 |
| 140 | Ga0466708_257192 | 3300042652 | Bacteria | 13471 |
| 141 | Ga0466708_378325 | 3300042652 | Bacteria | 5735 |
| 142 | Ga0264413_121451 | 3300024493 | Bacteria | 2799 |
| 143 | Ga0456237_0008054 | 3300041968 | Unclassified | 1607 |
| 144 | Ga0466691_008420 | 3300042593 | Bacteria | 9742 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.