Protein Family IF09835
Metagenome
Isolate
185
Members
73
Samples
154
Scaffolds
280.81
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_036363|Ga0466708_036363_3276_4247
- Length
- 323 aa
- Sequence
- MQKQACHNRSLGFLEVPTVSPAYCIIFVREYFKMNGLLINAAMKTNYEIRYAAHPEDAKQYDTARLRRDFLIEKLFEPDEVQLVYSMYDRMIAGGAMPVKEKLRLEAIPPLKQPFFLRNREIGIYHVGGSTGMVHIGDDSFELQYKEALYLGSGDRELYFESTDPQSPSLFYFNSTTAHRNRPDKKITRNEAVIAEMGAPETSNHRHVNKMIVNQVLPTCQLQMGMTELAVGSVWNTMPAHIHSRRMEVYFYFEVPEEQAVCHFMGEPFETRHIWMKGRQAVLSPEWSIHSAAATSNYTFIWGMGGENLDYGDQDFFKITELK
Sample Types
Isolate
16.8%
Metagenome
83.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.8%
Kalotermitidae
19.7%
Termitidae
18.3%
Unclassified
8.5%
Rhinotermitidae
7.0%
Armadillidiidae
4.2%
Termopsidae
4.2%
Passalidae
2.8%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
175
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 2 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 3 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 11 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 12 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 13 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 16 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 17 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 20 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 21 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 22 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 30 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 33 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 39 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 40 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 41 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 42 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 43 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 44 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 52 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 53 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 54 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 55 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 56 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 67 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 68 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_302559 | 3300042612 | Bacteria | 1211 |
| 2 | Ga0466733_177981 | 3300042659 | Bacteria | 1661 |
| 3 | Ga0466715_051157 | 3300042616 | Bacteria | 50381 |
| 4 | Ga0466723_035858 | 3300042618 | Bacteria | 52046 |
| 5 | Ga0466723_329006 | 3300042618 | Bacteria | 14408 |
| 6 | Ga0466728_070833 | 3300042620 | Bacteria | 41238 |
| 7 | Ga0123357_10054852 | 3300009784 | Unclassified | 5370 |
| 8 | Ga0123357_10224568 | 3300009784 | Bacteria | 2075 |
| 9 | Ga0466706_059970 | 3300042599 | Bacteria | 23340 |
| 10 | Ga0466706_094212 | 3300042599 | Bacteria | 15235 |
| 11 | Ga0466706_140343 | 3300042599 | Bacteria | 15711 |
| 12 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 13 | Ga0466719_156952 | 3300042606 | Unclassified | 4658 |
| 14 | Ga0466691_203760 | 3300042593 | Bacteria | 22262 |
| 15 | Ga0466734_049972 | 3300042623 | Bacteria | 1455 |
| 16 | Ga0466735_077476 | 3300042624 | Bacteria | 3230 |
| 17 | Ga0466703_130753 | 3300042636 | Bacteria | 9893 |
| 18 | Ga0466703_374980 | 3300042636 | Bacteria | 2027 |
| 19 | Ga0466727_251974 | 3300042655 | Bacteria | 41475 |
| 20 | Ga0466705_126070 | 3300042612 | Bacteria | 23735 |
| 21 | Ga0466733_167333 | 3300042659 | Bacteria | 2489 |
| 22 | JGI24699J35502_11133510 | 3300002509 | Bacteria | 11319 |
| 23 | JGI24699J35502_11133861 | 3300002509 | Bacteria | 17399 |
| 24 | Ga0466705_436235 | 3300042612 | Bacteria | 8441 |
| 25 | Ga0466711_014387 | 3300042615 | Bacteria | 11413 |
| 26 | Ga0466726_145705 | 3300042619 | Bacteria | 31377 |
| 27 | Ga0123353_10710571 | 3300010167 | Bacteria | 1408 |
| 28 | Ga0123354_10066467 | 3300010882 | Bacteria | 5264 |
| 29 | Ga0123354_10109791 | 3300010882 | Bacteria | 3652 |
| 30 | Ga0466700_262615 | 3300042600 | Bacteria | 9989 |
| 31 | Ga0466716_147451 | 3300042605 | Bacteria | 22878 |
| 32 | Ga0466716_308756 | 3300042605 | Bacteria | 5345 |
| 33 | Ga0466722_054466 | 3300042609 | Bacteria | 10893 |
| 34 | Ga0160444_101389 | 3300012841 | Unclassified | 4785 |
| 35 | Ga0265387_1000217 | 3300024582 | Bacteria | 10028 |
| 36 | Ga0466690_327307 | 3300042590 | Bacteria | 13972 |
| 37 | Ga0466691_228206 | 3300042593 | Bacteria | 1497 |
| 38 | Ga0466696_003763 | 3300042596 | Bacteria | 106079 |
| 39 | Ga0466696_017736 | 3300042596 | Unclassified | 4143 |
| 40 | Ga0466696_035748 | 3300042596 | Bacteria | 10479 |
| 41 | Ga0466696_241948 | 3300042596 | Bacteria | 2674 |
| 42 | Ga0466699_289528 | 3300042597 | Bacteria | 3315 |
| 43 | Ga0466703_390239 | 3300042636 | Bacteria | 3060 |
| 44 | Ga0466705_009950 | 3300042612 | Bacteria | 28016 |
| 45 | Ga0466733_206577 | 3300042659 | Bacteria | 22282 |
| 46 | Ga0123357_10001211 | 3300009784 | Bacteria | 26983 |
| 47 | Ga0466711_359360 | 3300042615 | Bacteria | 14266 |
| 48 | Ga0466726_328337 | 3300042619 | Bacteria | 2339 |
| 49 | Ga0466728_009673 | 3300042620 | Bacteria | 2472 |
| 50 | Ga0466728_143836 | 3300042620 | Bacteria | 3848 |
| 51 | Ga0123353_10164665 | 3300010167 | Bacteria | 3526 |
| 52 | Ga0123354_10147645 | 3300010882 | Bacteria | 2869 |
| 53 | Ga0466706_047496 | 3300042599 | Bacteria | 8216 |
| 54 | Ga0466706_072928 | 3300042599 | Bacteria | 51016 |
| 55 | Ga0466706_151415 | 3300042599 | Bacteria | 14671 |
| 56 | Ga0466707_258930 | 3300042601 | Bacteria | 22459 |
| 57 | Ga0160469_101431 | 3300012824 | Bacteria | 6370 |
| 58 | Ga0466692_049439 | 3300042591 | Bacteria | 34933 |
| 59 | Ga0466735_107465 | 3300042624 | Bacteria | 1179 |
| 60 | Ga0466704_313968 | 3300042643 | Bacteria | 4576 |
| 61 | Ga0466704_316220 | 3300042643 | Bacteria | 5871 |
| 62 | Ga0466708_036363 | 3300042652 | Bacteria | 9973 |
| 63 | Ga0466708_461535 | 3300042652 | Bacteria | 12713 |
| 64 | Ga0466697_276902 | 3300042611 | Bacteria | 1024 |
| 65 | Ga0068305_10001223 | 3300005083 | Bacteria | 98255 |
| 66 | Ga0466711_118278 | 3300042615 | Bacteria | 21306 |
| 67 | Ga0123357_10041797 | 3300009784 | Bacteria | 6235 |
| 68 | Ga0123354_10039410 | 3300010882 | Bacteria | 7323 |
| 69 | Ga0466706_031962 | 3300042599 | Bacteria | 11375 |
| 70 | Ga0466706_034191 | 3300042599 | Bacteria | 44289 |
| 71 | Ga0466714_050410 | 3300042603 | Bacteria | 40060 |
| 72 | Ga0466714_090485 | 3300042603 | Bacteria | 2712 |
| 73 | Ga0466719_319297 | 3300042606 | Bacteria | 2498 |
| 74 | Ga0466722_200952 | 3300042609 | Bacteria | 7045 |
| 75 | Ga0466690_011526 | 3300042590 | Bacteria | 10291 |
| 76 | Ga0466696_444554 | 3300042596 | Bacteria | 19303 |
| 77 | Ga0466735_197760 | 3300042624 | Bacteria | 2288 |
| 78 | Ga0466709_301311 | 3300042648 | Bacteria | 10280 |
| 79 | IMNBL1DRAFT_c0002776 | 3300000062 | Bacteria | 11890 |
| 80 | Ga0068305_10208188 | 3300005083 | Bacteria | 4107 |
| 81 | Ga0466711_055238 | 3300042615 | Bacteria | 16327 |
| 82 | Ga0466715_038292 | 3300042616 | Bacteria | 5020 |
| 83 | Ga0466728_303164 | 3300042620 | Bacteria | 28612 |
| 84 | Ga0123354_10000099 | 3300010882 | Bacteria | 64622 |
| 85 | Ga0466706_074152 | 3300042599 | Bacteria | 1658 |
| 86 | Ga0466716_020038 | 3300042605 | Bacteria | 33350 |
| 87 | Ga0466716_074068 | 3300042605 | Bacteria | 5581 |
| 88 | Ga0466719_504944 | 3300042606 | Bacteria | 2660 |
| 89 | Ga0466722_200664 | 3300042609 | Bacteria | 9551 |
| 90 | Ga0466657_325607 | 3300042582 | Bacteria | 1955 |
| 91 | Ga0466696_248437 | 3300042596 | Bacteria | 1604 |
| 92 | Ga0466735_042821 | 3300042624 | Bacteria | 2602 |
| 93 | Ga0466727_259681 | 3300042655 | Bacteria | 9175 |
| 94 | Ga0466729_107895 | 3300042621 | Bacteria | 2939 |
| 95 | Ga0123357_10004567 | 3300009784 | Bacteria | 16299 |
| 96 | Ga0123357_10078067 | 3300009784 | Unclassified | 4365 |
| 97 | Ga0123357_10134841 | 3300009784 | Bacteria | 3058 |
| 98 | Ga0123354_10285182 | 3300010882 | Bacteria | 1595 |
| 99 | Ga0466701_073331 | 3300042598 | Bacteria | 1132 |
| 100 | Ga0466706_052347 | 3300042599 | Bacteria | 5149 |
| 101 | Ga0466706_226311 | 3300042599 | Bacteria | 10163 |
| 102 | Ga0466707_322791 | 3300042601 | Bacteria | 29199 |
| 103 | Ga0466714_013660 | 3300042603 | Unclassified | 1383 |
| 104 | Ga0466714_072285 | 3300042603 | Bacteria | 4885 |
| 105 | Ga0466714_154944 | 3300042603 | Bacteria | 103066 |
| 106 | Ga0466692_003319 | 3300042591 | Bacteria | 71632 |
| 107 | Ga0466691_187524 | 3300042593 | Bacteria | 8186 |
| 108 | Ga0466696_280513 | 3300042596 | Unclassified | 1989 |
| 109 | Ga0466696_431230 | 3300042596 | Bacteria | 2404 |
| 110 | Ga0466735_036712 | 3300042624 | Bacteria | 2329 |
| 111 | Ga0466703_183704 | 3300042636 | Bacteria | 3343 |
| 112 | Ga0466704_263554 | 3300042643 | Unclassified | 1531 |
| 113 | Ga0466709_113294 | 3300042648 | Bacteria | 28711 |
| 114 | Ga0466725_085064 | 3300042654 | Bacteria | 1186 |
| 115 | Ga0466727_291497 | 3300042655 | Bacteria | 1683 |
| 116 | Ga0466705_172676 | 3300042612 | Bacteria | 3864 |
| 117 | Ga0466705_210712 | 3300042612 | Bacteria | 1576 |
| 118 | Ga0466711_403972 | 3300042615 | Bacteria | 61875 |
| 119 | Ga0466715_011112 | 3300042616 | Bacteria | 16804 |
| 120 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 121 | Ga0466726_371359 | 3300042619 | Bacteria | 11043 |
| 122 | Ga0466729_090939 | 3300042621 | Bacteria | 9735 |
| 123 | Ga0123354_10148889 | 3300010882 | Bacteria | 2848 |
| 124 | Ga0466700_271423 | 3300042600 | Bacteria | 2854 |
| 125 | Ga0466707_119211 | 3300042601 | Bacteria | 2972 |
| 126 | Ga0466713_012561 | 3300042602 | Bacteria | 3244 |
| 127 | Ga0466719_451335 | 3300042606 | Bacteria | 1815 |
| 128 | Ga0466722_031735 | 3300042609 | Bacteria | 1151 |
| 129 | Ga0160433_100831 | 3300012846 | Unclassified | 11024 |
| 130 | Ga0466690_092512 | 3300042590 | Bacteria | 12938 |
| 131 | Ga0466703_330870 | 3300042636 | Bacteria | 1825 |
| 132 | Ga0466704_036765 | 3300042643 | Bacteria | 16967 |
| 133 | Ga0466708_019276 | 3300042652 | Bacteria | 21307 |
| 134 | Ga0466708_164096 | 3300042652 | Bacteria | 7334 |
| 135 | Ga0466733_095282 | 3300042659 | Bacteria | 5457 |
| 136 | Ga0466733_113480 | 3300042659 | Bacteria | 2218 |
| 137 | 2227153022 | 2225789004 | Bacteria | 8525 |
| 138 | Ga0466715_409757 | 3300042616 | Bacteria | 45403 |
| 139 | Ga0123357_10111153 | 3300009784 | Bacteria | 3492 |
| 140 | Ga0123354_10034725 | 3300010882 | Bacteria | 7883 |
| 141 | Ga0466706_253279 | 3300042599 | Bacteria | 2379 |
| 142 | Ga0466700_347223 | 3300042600 | Bacteria | 6265 |
| 143 | Ga0466722_173580 | 3300042609 | Bacteria | 1979 |
| 144 | Ga0160453_100767 | 3300012814 | Bacteria | 18070 |
| 145 | Ga0466690_307159 | 3300042590 | Bacteria | 1501 |
| 146 | Ga0466692_202921 | 3300042591 | Bacteria | 23461 |
| 147 | Ga0466691_080667 | 3300042593 | Bacteria | 14393 |
| 148 | Ga0466691_183265 | 3300042593 | Bacteria | 11148 |
| 149 | Ga0466696_190324 | 3300042596 | Bacteria | 2643 |
| 150 | Ga0466735_005377 | 3300042624 | Bacteria | 3261 |
| 151 | Ga0466735_115470 | 3300042624 | Unclassified | 4379 |
| 152 | Ga0466735_141629 | 3300042624 | Bacteria | 6302 |
| 153 | Ga0466709_287914 | 3300042648 | Bacteria | 5883 |
| 154 | Ga0466708_321419 | 3300042652 | Bacteria | 16374 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04962 | KduI | KduI/IolB family | 139 | 308 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04962 | GO:0016861 | intramolecular oxidoreductase activity, interconverting aldoses and ketoses | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.