Protein Family IF09791
Metagenome
Isolate
134
Members
46
Samples
130
Scaffolds
406.32
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_53255|Ga0466724_53255_1913_3130
- Length
- 393 aa
- Sequence
- MEGENWMDIRNDRLKGMNYKEIGRKYHIDPRTAKKYAESETRPKYVLSEPKASKLDDFKQQIDIWLEEAPYSAIRIYEKLSDQGFDGKYSIVKQYVRCKKMDLDEKATVRFETMPGLQGQMDWAYFEDHRVIEEGKEKKLYCFLMVLGYSRMRYIEFVTDMTTNTMIRCHANAFRYFGGYPEEMLYDNMKQVVIKRLLKQEDSTLNRQFEDFAGFYGFKPVLCRPYRGQTKGKVERTVGYVRDNFMVGIKYDTLDDLNGQAHAWCNKVFERLGKENLNPLKREYIIDKINLRRVQKDCLISYGGNQYSVPSEYVGRDVAVIGLDNMLAVYHETKQIALHRLSYQNKDMVVNANHYRKLTVKQSFDVDNTLLSDEDTIDFPIRPHDLRRYDEVV
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.4%
Unclassified
13.3%
Kalotermitidae
6.7%
Passalidae
4.4%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 4 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 33 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10219854 | 3300009826 | Bacteria | 2734 |
| 2 | Ga0123355_10484349 | 3300009826 | Bacteria | 1537 |
| 3 | Ga0123354_10193226 | 3300010882 | Bacteria | 2269 |
| 4 | 2227576569 | 2225789004 | Bacteria | 2556 |
| 5 | Ga0466734_073100 | 3300042623 | Bacteria | 1681 |
| 6 | Ga0466724_53255 | 3300042649 | Bacteria | 3335 |
| 7 | Ga0466725_451890 | 3300042654 | Bacteria | 3267 |
| 8 | Ga0415639_020705 | 3300038395 | Bacteria | 2169 |
| 9 | Ga0415639_032070 | 3300038395 | Bacteria | 1994 |
| 10 | Ga0466696_371525 | 3300042596 | Bacteria | 2510 |
| 11 | Ga0466707_019467 | 3300042601 | Archaea | 3425 |
| 12 | Ga0466713_115491 | 3300042602 | Bacteria | 1837 |
| 13 | Ga0466717_002232 | 3300042604 | Bacteria | 2511 |
| 14 | Ga0466721_197600 | 3300042608 | Bacteria | 2865 |
| 15 | Ga0466732_127823 | 3300042656 | Bacteria | 2612 |
| 16 | Ga0123356_10161692 | 3300010049 | Bacteria | 2237 |
| 17 | Ga0123356_10231115 | 3300010049 | Bacteria | 1914 |
| 18 | Ga0123353_10271861 | 3300010167 | Bacteria | 2610 |
| 19 | Ga0123353_10311307 | 3300010167 | Bacteria | 2396 |
| 20 | Ga0123354_10309847 | 3300010882 | Bacteria | 1476 |
| 21 | 2227120274 | 2225789004 | Bacteria | 1704 |
| 22 | 2227606583 | 2225789004 | Bacteria | 2293 |
| 23 | IMNBL1DRAFT_c0035585 | 3300000062 | Unclassified | 1753 |
| 24 | Ga0072941_1191741 | 3300005201 | Bacteria | 4721 |
| 25 | Ga0466693_345023 | 3300042592 | Bacteria | 2835 |
| 26 | Ga0466700_008978 | 3300042600 | Bacteria | 2410 |
| 27 | Ga0466698_259340 | 3300042610 | Unclassified | 2000 |
| 28 | Ga0123356_10257916 | 3300010049 | Bacteria | 1825 |
| 29 | Ga0123353_10109737 | 3300010167 | Unclassified | 4445 |
| 30 | Ga0123353_10287758 | 3300010167 | Bacteria | 2518 |
| 31 | Ga0123354_10163277 | 3300010882 | Bacteria | 2631 |
| 32 | 2227619646 | 2225789004 | Bacteria | 2197 |
| 33 | IMNBL1DRAFT_c0025176 | 3300000062 | Bacteria | 2287 |
| 34 | JGI24705J35276_12222370 | 3300002504 | Bacteria | 2415 |
| 35 | Ga0466657_120812 | 3300042582 | Bacteria | 1709 |
| 36 | Ga0466693_249210 | 3300042592 | Bacteria | 2400 |
| 37 | Ga0466706_118946 | 3300042599 | Bacteria | 2972 |
| 38 | Ga0466717_024714 | 3300042604 | Bacteria | 2894 |
| 39 | Ga0466717_033823 | 3300042604 | Bacteria | 1828 |
| 40 | Ga0466705_041216 | 3300042612 | Bacteria | 2367 |
| 41 | Ga0123357_10216443 | 3300009784 | Bacteria | 2137 |
| 42 | Ga0123356_10056397 | 3300010049 | Bacteria | 3660 |
| 43 | Ga0123356_10133482 | 3300010049 | Bacteria | 2436 |
| 44 | Ga0123353_10296264 | 3300010167 | Bacteria | 2473 |
| 45 | Ga0123353_10628691 | 3300010167 | Bacteria | 1526 |
| 46 | 2227510203 | 2225789004 | Bacteria | 3578 |
| 47 | JGI24695J34938_10035622 | 3300002450 | Bacteria | 2274 |
| 48 | JGI24696J40584_12955790 | 3300002834 | Unclassified | 2926 |
| 49 | Ga0466729_251167 | 3300042621 | Bacteria | 1704 |
| 50 | Ga0415639_042645 | 3300038395 | Bacteria | 2131 |
| 51 | Ga0466693_345217 | 3300042592 | Bacteria | 4366 |
| 52 | Ga0466696_221709 | 3300042596 | Bacteria | 2577 |
| 53 | Ga0466696_237332 | 3300042596 | Bacteria | 3002 |
| 54 | Ga0466700_247879 | 3300042600 | Bacteria | 3861 |
| 55 | Ga0466707_196440 | 3300042601 | Bacteria | 2906 |
| 56 | Ga0466697_109466 | 3300042611 | Bacteria | 2600 |
| 57 | Ga0123355_10162387 | 3300009826 | Bacteria | 3362 |
| 58 | Ga0123355_10298332 | 3300009826 | Bacteria | 2201 |
| 59 | Ga0123355_10360117 | 3300009826 | Bacteria | 1917 |
| 60 | Ga0123355_10419879 | 3300009826 | Bacteria | 1710 |
| 61 | Ga0123356_10069058 | 3300010049 | Bacteria | 3313 |
| 62 | Ga0123356_10090472 | 3300010049 | Bacteria | 2914 |
| 63 | Ga0123353_10196290 | 3300010167 | Bacteria | 3181 |
| 64 | Ga0123353_10587788 | 3300010167 | Bacteria | 1595 |
| 65 | Ga0466734_100932 | 3300042623 | Bacteria | 2702 |
| 66 | Ga0466695_331297 | 3300042595 | Bacteria | 2316 |
| 67 | Ga0466696_480333 | 3300042596 | Bacteria | 3582 |
| 68 | Ga0466701_022813 | 3300042598 | Bacteria | 1587 |
| 69 | Ga0466700_014891 | 3300042600 | Bacteria | 2517 |
| 70 | Ga0466700_275927 | 3300042600 | Bacteria | 1482 |
| 71 | Ga0466714_026496 | 3300042603 | Bacteria | 1511 |
| 72 | Ga0123355_10235944 | 3300009826 | Bacteria | 2602 |
| 73 | Ga0123356_10106196 | 3300010049 | Bacteria | 2703 |
| 74 | Ga0123356_10133114 | 3300010049 | Bacteria | 2439 |
| 75 | Ga0123353_10219557 | 3300010167 | Bacteria | 2974 |
| 76 | Ga0123353_10285626 | 3300010167 | Bacteria | 2530 |
| 77 | Ga0123353_10618005 | 3300010167 | Bacteria | 1544 |
| 78 | JGI24696J40584_12951952 | 3300002834 | Bacteria | 2293 |
| 79 | Ga0072941_1164684 | 3300005201 | Bacteria | 2028 |
| 80 | Ga0466731_021535 | 3300042622 | Bacteria | 1627 |
| 81 | Ga0466731_273222 | 3300042622 | Bacteria | 2719 |
| 82 | Ga0466735_099462 | 3300042624 | Bacteria | 3353 |
| 83 | Ga0466704_496228 | 3300042643 | Bacteria | 4765 |
| 84 | Ga0415639_094169 | 3300038395 | Bacteria | 1859 |
| 85 | Ga0466693_186472 | 3300042592 | Bacteria | 2285 |
| 86 | Ga0466695_095441 | 3300042595 | Bacteria | 2108 |
| 87 | Ga0466696_459647 | 3300042596 | Bacteria | 2428 |
| 88 | Ga0466700_449123 | 3300042600 | Bacteria | 2736 |
| 89 | Ga0466717_001012 | 3300042604 | Unclassified | 3104 |
| 90 | Ga0466717_102145 | 3300042604 | Bacteria | 2450 |
| 91 | Ga0466698_474757 | 3300042610 | Bacteria | 2624 |
| 92 | Ga0466710_092453 | 3300042613 | Unclassified | 2940 |
| 93 | Ga0466726_031829 | 3300042619 | Bacteria | 3043 |
| 94 | Ga0123355_10116081 | 3300009826 | Bacteria | 4167 |
| 95 | Ga0123356_10067228 | 3300010049 | Bacteria | 3357 |
| 96 | Ga0123353_10296886 | 3300010167 | Bacteria | 2470 |
| 97 | Ga0123353_10390844 | 3300010167 | Unclassified | 2075 |
| 98 | IMNBL1DRAFT_c0026068 | 3300000062 | Bacteria | 2229 |
| 99 | JGI24705J35276_12220256 | 3300002504 | Bacteria | 2255 |
| 100 | JGI24696J40584_12951607 | 3300002834 | Bacteria | 2261 |
| 101 | Ga0072940_1149403 | 3300005200 | Bacteria | 2333 |
| 102 | Ga0466729_316079 | 3300042621 | Bacteria | 2338 |
| 103 | Ga0466735_131805 | 3300042624 | Unclassified | 2197 |
| 104 | Ga0466693_406896 | 3300042592 | Bacteria | 2665 |
| 105 | Ga0466707_109212 | 3300042601 | Bacteria | 2362 |
| 106 | Ga0466714_112079 | 3300042603 | Bacteria | 1865 |
| 107 | Ga0466720_109270 | 3300042607 | Bacteria | 4617 |
| 108 | Ga0466721_044529 | 3300042608 | Bacteria | 17486 |
| 109 | Ga0466697_039026 | 3300042611 | Bacteria | 1880 |
| 110 | Ga0123357_10311558 | 3300009784 | Bacteria | 1571 |
| 111 | Ga0123355_10202907 | 3300009826 | Bacteria | 2892 |
| 112 | Ga0123355_10312022 | 3300009826 | Bacteria | 2130 |
| 113 | Ga0123356_10151348 | 3300010049 | Bacteria | 2304 |
| 114 | Ga0123356_10173167 | 3300010049 | Bacteria | 2171 |
| 115 | Ga0123353_10243688 | 3300010167 | Unclassified | 2791 |
| 116 | Ga0123353_10329600 | 3300010167 | Bacteria | 2311 |
| 117 | Ga0123353_10352939 | 3300010167 | Bacteria | 2215 |
| 118 | Ga0123353_10353553 | 3300010167 | Bacteria | 2212 |
| 119 | Ga0123353_10704017 | 3300010167 | Bacteria | 1417 |
| 120 | 2227637677 | 2225789004 | Bacteria | 2079 |
| 121 | Ga0415639_052975 | 3300038395 | Bacteria | 2274 |
| 122 | Ga0415639_205405 | 3300038395 | Bacteria | 1480 |
| 123 | Ga0466694_125744 | 3300042594 | Bacteria | 2370 |
| 124 | Ga0466694_305263 | 3300042594 | Bacteria | 2048 |
| 125 | Ga0466699_376958 | 3300042597 | Bacteria | 2556 |
| 126 | Ga0466714_168876 | 3300042603 | Bacteria | 2609 |
| 127 | Ga0466721_056945 | 3300042608 | Bacteria | 2571 |
| 128 | Ga0466721_157799 | 3300042608 | Bacteria | 2220 |
| 129 | Ga0466722_117746 | 3300042609 | Bacteria | 1684 |
| 130 | Ga0466698_200925 | 3300042610 | Bacteria | 2471 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_020705 | Ga0415639_020705_121_1194 | 357 |
| 2 | 3300042603 | Ga0466714_026496 | Ga0466714_026496_305_1405 | 366 |
| 3 | 3300042610 | Ga0466698_474757 | Ga0466698_474757_1197_2408 | 378 |
| 4 | 3300042619 | Ga0466726_031829 | Ga0466726_031829_1746_2948 | 378 |
| 5 | 3300042623 | Ga0466734_073100 | Ga0466734_073100_37_1182 | 381 |
| 6 | 3300042608 | Ga0466721_157799 | Ga0466721_157799_186_1340 | 384 |
| 7 | 3300042621 | Ga0466729_251167 | Ga0466729_251167_176_1393 | 385 |
| 8 | 3300042621 | Ga0466729_316079 | Ga0466729_316079_223_1395 | 390 |
| 9 | 3300009784 | Ga0123357_10216443 | Ga0123357_102164432 | 391 |
| 10 | 3300000062 | IMNBL1DRAFT_c0035585 | IMNBL1DRAFT_00355852 | 392 |
| 11 | 3300042649 | Ga0466724_53255 | Ga0466724_53255_1913_3130 | 393 |
| 12 | 3300042656 | Ga0466732_127823 | Ga0466732_127823_494_1714 | 393 |
| 13 | 3300009826 | Ga0123355_10235944 | Ga0123355_102359443 | 394 |
| 14 | iso_pr_bacteria | 2820080004 | 2820082730 | 399 |
| 15 | 2225789004 | 2227619646 | 2228197651 | 400 |
| 16 | 3300042601 | Ga0466707_109212 | Ga0466707_109212_142_1344 | 400 |
| 17 | 3300042612 | Ga0466705_041216 | Ga0466705_041216_293_1495 | 400 |
| 18 | 3300042624 | Ga0466735_131805 | Ga0466735_131805_280_1482 | 400 |
| 19 | 2225789004 | 2227637677 | 2228225391 | 401 |
| 20 | 3300002504 | JGI24705J35276_12222370 | JGI24705J35276_122223702 | 402 |
| 21 | 3300005201 | Ga0072941_1191741 | Ga0072941_11917414 | 402 |
| 22 | 3300042596 | Ga0466696_221709 | Ga0466696_221709_296_1504 | 402 |
| 23 | 3300042600 | Ga0466700_247879 | Ga0466700_247879_987_2195 | 402 |
| 24 | iso_pr_bacteria | 2820327087 | 2820329818 | 402 |
| 25 | iso_pr_bacteria | 2820657860 | 2820658145 | 402 |
| 26 | 3300002450 | JGI24695J34938_10035622 | JGI24695J34938_100356221 | 403 |
| 27 | 3300002834 | JGI24696J40584_12955790 | JGI24696J40584_129557902 | 403 |
| 28 | 3300005201 | Ga0072941_1164684 | Ga0072941_11646842 | 403 |
| 29 | 3300042622 | Ga0466731_021535 | Ga0466731_021535_241_1452 | 403 |
| 30 | 3300042623 | Ga0466734_100932 | Ga0466734_100932_1043_2254 | 403 |
| 31 | iso_pr_bacteria | 2820634724 | 2820635831 | 403 |
| 32 | 2225789004 | 2227120274 | 2227513003 | 404 |
| 33 | 2225789004 | 2227606583 | 2228175869 | 404 |
| 34 | 3300009826 | Ga0123355_10162387 | Ga0123355_101623874 | 404 |
| 35 | 3300010167 | Ga0123353_10311307 | Ga0123353_103113072 | 404 |
| 36 | 2225789004 | 2227510203 | 2228003558 | 405 |
| 37 | 3300000062 | IMNBL1DRAFT_c0026068 | IMNBL1DRAFT_00260683 | 405 |
| 38 | 3300038395 | Ga0415639_032070 | Ga0415639_032070_68_1285 | 405 |
| 39 | 3300042594 | Ga0466694_305263 | Ga0466694_305263_630_1847 | 405 |
| 40 | 3300042613 | Ga0466710_092453 | Ga0466710_092453_1491_2708 | 405 |
| 41 | 3300000062 | IMNBL1DRAFT_c0025176 | IMNBL1DRAFT_00251761 | 406 |
| 42 | 3300010167 | Ga0123353_10271861 | Ga0123353_102718611 | 406 |
| 43 | 3300010167 | Ga0123353_10329600 | Ga0123353_103296003 | 406 |
| 44 | 3300010882 | Ga0123354_10163277 | Ga0123354_101632772 | 406 |
| 45 | 3300042595 | Ga0466695_095441 | Ga0466695_095441_56_1276 | 406 |
| 46 | 3300042596 | Ga0466696_237332 | Ga0466696_237332_404_1624 | 406 |
| 47 | 3300042596 | Ga0466696_371525 | Ga0466696_371525_461_1681 | 406 |
| 48 | 3300042596 | Ga0466696_480333 | Ga0466696_480333_268_1488 | 406 |
| 49 | 3300042601 | Ga0466707_019467 | Ga0466707_019467_853_2073 | 406 |
| 50 | 3300042601 | Ga0466707_196440 | Ga0466707_196440_1247_2467 | 406 |
| 51 | 3300042611 | Ga0466697_039026 | Ga0466697_039026_417_1637 | 406 |
| 52 | 3300042624 | Ga0466735_099462 | Ga0466735_099462_791_2011 | 406 |
| 53 | 3300009784 | Ga0123357_10311558 | Ga0123357_103115582 | 407 |
| 54 | 3300010049 | Ga0123356_10151348 | Ga0123356_101513483 | 407 |
| 55 | 3300010167 | Ga0123353_10285626 | Ga0123353_102856262 | 407 |
| 56 | 3300010167 | Ga0123353_10704017 | Ga0123353_107040172 | 407 |
| 57 | 3300010882 | Ga0123354_10309847 | Ga0123354_103098472 | 407 |
| 58 | 3300038395 | Ga0415639_042645 | Ga0415639_042645_850_2073 | 407 |
| 59 | 3300038395 | Ga0415639_052975 | Ga0415639_052975_113_1336 | 407 |
| 60 | 3300042592 | Ga0466693_249210 | Ga0466693_249210_948_2171 | 407 |
| 61 | 3300042592 | Ga0466693_345023 | Ga0466693_345023_637_1860 | 407 |
| 62 | 3300042594 | Ga0466694_125744 | Ga0466694_125744_945_2168 | 407 |
| 63 | 3300042595 | Ga0466695_331297 | Ga0466695_331297_1037_2260 | 407 |
| 64 | 3300042597 | Ga0466699_376958 | Ga0466699_376958_243_1466 | 407 |
| 65 | 3300042600 | Ga0466700_008978 | Ga0466700_008978_907_2130 | 407 |
| 66 | 3300042603 | Ga0466714_112079 | Ga0466714_112079_400_1623 | 407 |
| 67 | 3300042604 | Ga0466717_024714 | Ga0466717_024714_1139_2362 | 407 |
| 68 | 3300042604 | Ga0466717_102145 | Ga0466717_102145_991_2214 | 407 |
| 69 | 3300042607 | Ga0466720_109270 | Ga0466720_109270_1450_2673 | 407 |
| 70 | 3300042610 | Ga0466698_259340 | Ga0466698_259340_258_1481 | 407 |
| 71 | 3300042654 | Ga0466725_451890 | Ga0466725_451890_812_2035 | 407 |
| 72 | 3300002834 | JGI24696J40584_12951607 | JGI24696J40584_129516072 | 408 |
| 73 | 3300002834 | JGI24696J40584_12951952 | JGI24696J40584_129519521 | 408 |
| 74 | 3300009826 | Ga0123355_10202907 | Ga0123355_102029072 | 408 |
| 75 | 3300009826 | Ga0123355_10298332 | Ga0123355_102983323 | 408 |
| 76 | 3300010049 | Ga0123356_10056397 | Ga0123356_100563972 | 408 |
| 77 | 3300010049 | Ga0123356_10069058 | Ga0123356_100690582 | 408 |
| 78 | 3300010049 | Ga0123356_10106196 | Ga0123356_101061963 | 408 |
| 79 | 3300010049 | Ga0123356_10133482 | Ga0123356_101334822 | 408 |
| 80 | 3300010049 | Ga0123356_10231115 | Ga0123356_102311151 | 408 |
| 81 | 3300010049 | Ga0123356_10257916 | Ga0123356_102579162 | 408 |
| 82 | 3300010167 | Ga0123353_10196290 | Ga0123353_101962903 | 408 |
| 83 | 3300010167 | Ga0123353_10243688 | Ga0123353_102436883 | 408 |
| 84 | 3300010167 | Ga0123353_10296886 | Ga0123353_102968861 | 408 |
| 85 | 3300010167 | Ga0123353_10352939 | Ga0123353_103529392 | 408 |
| 86 | 3300010167 | Ga0123353_10390844 | Ga0123353_103908441 | 408 |
| 87 | 3300010167 | Ga0123353_10587788 | Ga0123353_105877882 | 408 |
| 88 | 3300010167 | Ga0123353_10628691 | Ga0123353_106286911 | 408 |
| 89 | 3300042582 | Ga0466657_120812 | Ga0466657_120812_193_1419 | 408 |
| 90 | 3300042592 | Ga0466693_345217 | Ga0466693_345217_2556_3782 | 408 |
| 91 | 3300042598 | Ga0466701_022813 | Ga0466701_022813_138_1364 | 408 |
| 92 | 3300042600 | Ga0466700_275927 | Ga0466700_275927_219_1445 | 408 |
| 93 | 3300042603 | Ga0466714_168876 | Ga0466714_168876_239_1465 | 408 |
| 94 | 3300042604 | Ga0466717_001012 | Ga0466717_001012_1670_2896 | 408 |
| 95 | 3300042604 | Ga0466717_033823 | Ga0466717_033823_119_1345 | 408 |
| 96 | 3300042608 | Ga0466721_197600 | Ga0466721_197600_206_1432 | 408 |
| 97 | 3300005200 | Ga0072940_1149403 | Ga0072940_11494032 | 409 |
| 98 | 3300010049 | Ga0123356_10090472 | Ga0123356_100904722 | 409 |
| 99 | 3300010167 | Ga0123353_10109737 | Ga0123353_101097373 | 409 |
| 100 | 3300010167 | Ga0123353_10219557 | Ga0123353_102195573 | 409 |
| 101 | 3300010167 | Ga0123353_10353553 | Ga0123353_103535532 | 409 |
| 102 | 3300042599 | Ga0466706_118946 | Ga0466706_118946_996_2225 | 409 |
| 103 | 3300042600 | Ga0466700_014891 | Ga0466700_014891_269_1498 | 409 |
| 104 | 3300042608 | Ga0466721_044529 | Ga0466721_044529_5514_6743 | 409 |
| 105 | 3300042608 | Ga0466721_056945 | Ga0466721_056945_353_1582 | 409 |
| 106 | 3300009826 | Ga0123355_10219854 | Ga0123355_102198543 | 410 |
| 107 | 3300009826 | Ga0123355_10484349 | Ga0123355_104843491 | 410 |
| 108 | 3300010049 | Ga0123356_10067228 | Ga0123356_100672282 | 410 |
| 109 | 3300010167 | Ga0123353_10618005 | Ga0123353_106180052 | 410 |
| 110 | 3300042592 | Ga0466693_186472 | Ga0466693_186472_214_1446 | 410 |
| 111 | 3300010167 | Ga0123353_10296264 | Ga0123353_102962641 | 411 |
| 112 | 3300010882 | Ga0123354_10193226 | Ga0123354_101932263 | 411 |
| 113 | 3300042596 | Ga0466696_459647 | Ga0466696_459647_941_2176 | 411 |
| 114 | 3300042600 | Ga0466700_449123 | Ga0466700_449123_355_1590 | 411 |
| 115 | 3300042604 | Ga0466717_002232 | Ga0466717_002232_287_1522 | 411 |
| 116 | 3300042611 | Ga0466697_109466 | Ga0466697_109466_878_2113 | 411 |
| 117 | 3300042622 | Ga0466731_273222 | Ga0466731_273222_619_1854 | 411 |
| 118 | 3300002504 | JGI24705J35276_12220256 | JGI24705J35276_122202561 | 412 |
| 119 | 3300009826 | Ga0123355_10312022 | Ga0123355_103120221 | 412 |
| 120 | 3300009826 | Ga0123355_10360117 | Ga0123355_103601172 | 412 |
| 121 | 3300010167 | Ga0123353_10287758 | Ga0123353_102877583 | 412 |
| 122 | 3300042592 | Ga0466693_406896 | Ga0466693_406896_395_1636 | 413 |
| 123 | 3300010049 | Ga0123356_10161692 | Ga0123356_101616921 | 415 |
| 124 | 3300042602 | Ga0466713_115491 | Ga0466713_115491_363_1625 | 420 |
| 125 | 3300009826 | Ga0123355_10419879 | Ga0123355_104198792 | 423 |
| 126 | 3300010049 | Ga0123356_10133114 | Ga0123356_101331143 | 423 |
| 127 | 3300010049 | Ga0123356_10173167 | Ga0123356_101731672 | 423 |
| 128 | 3300042610 | Ga0466698_200925 | Ga0466698_200925_240_1511 | 423 |
| 129 | 3300042609 | Ga0466722_117746 | Ga0466722_117746_341_1618 | 425 |
| 130 | 3300042643 | Ga0466704_496228 | Ga0466704_496228_1449_2726 | 425 |
| 131 | 3300009826 | Ga0123355_10116081 | Ga0123355_101160812 | 430 |
| 132 | 3300038395 | Ga0415639_094169 | Ga0415639_094169_116_1411 | 431 |
| 133 | 2225789004 | 2227576569 | 2228125393 | 437 |
| 134 | 3300038395 | Ga0415639_205405 | Ga0415639_205405_108_1445 | 445 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00665 | GO:0015074 | DNA integration | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.41 | 0.47 | Low |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.