Protein Family IF09770
Metagenome
Metatranscriptome
Isolate
209
Members
99
Samples
167
Scaffolds
443.68
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_43483|Ga0466724_43483_3683_5062
- Length
- 459 aa
- Sequence
- VKILILKTKLFGKTYEFKSLREVMAKANEEKSGDKLAGIAAQSAEERVAAKVVLSHITLADLRNNPAVPYEEDEVTRIIQDGVNETIYNEIKGKTVSEFREWILDTQTSGEMIKHASRGMTAEMVAAVCKLMSNLDLVYGAKKIVITAHCNTTIGLPGTFSSRLQPNHTTDDPKGIMASLMEGFSLGCGDAVLGLNPVDDSTESVARILSSFDEFKRKWEVPTQICVLAHVTTQMDAIQKFNAPIDLLFQSIAGSQKGNEAFGLTGTMLDEAHDMMLKHGTCTGPNVMYFETGQGAELSAEAHNGWDQVTMEARCYGLAKRYNPFLVNTVVGFIGPEYLYDSKQVIRAGLEDHFMGKLSGVSMGCDACYTNHMKADQNDIENLATLLVAAGCNYIMGVPQGDDCMLMYQCTGYNEAATLREIFGLRPIKEFDMWLEKMGFSKDGKLTPLAGDASVFMSK
Sample Types
Isolate
20.1%
Metagenome
79.0%
MAG
0.0%
Metatranscriptome
1.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
24.7%
Termitidae
23.7%
Kalotermitidae
15.1%
Apidae
7.5%
Tenebrionidae
6.5%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Drosophilidae
3.2%
Blattidae
2.2%
Formicidae
2.2%
Elmidae
1.1%
Passalidae
1.1%
Libellulidae
1.1%
Bombycidae
1.1%
Calliphoridae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 4 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 5 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 6 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 7 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 10 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 14 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 20 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 21 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 25 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 26 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 27 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 33 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 34 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 35 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 40 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 41 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 46 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 47 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 53 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 54 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 55 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 56 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 57 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 58 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 59 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 60 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 64 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 65 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 66 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 67 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 68 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 69 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 70 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 71 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 72 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 76 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 77 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 78 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 79 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 80 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 81 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 82 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 83 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 84 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 85 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 86 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 87 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 88 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 89 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 90 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 91 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 92 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 93 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 94 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 95 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 96 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 97 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 98 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 99 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10012101 | 3300002449 | Bacteria | 4734 |
| 2 | JGI24698J34947_10029636 | 3300002449 | Bacteria | 2890 |
| 3 | Ga0068305_10061910 | 3300005083 | Bacteria | 11319 |
| 4 | Ga0123357_10001005 | 3300009784 | Bacteria | 28869 |
| 5 | Ga0123355_10029319 | 3300009826 | Bacteria | 8906 |
| 6 | Ga0466705_411571 | 3300042612 | Bacteria | 9119 |
| 7 | Ga0466711_483506 | 3300042615 | Bacteria | 4607 |
| 8 | Ga0466715_314467 | 3300042616 | Bacteria | 26093 |
| 9 | Ga0466715_353133 | 3300042616 | Bacteria | 33453 |
| 10 | Ga0466715_462653 | 3300042616 | Bacteria | 2329 |
| 11 | Ga0466723_012162 | 3300042618 | Bacteria | 2734 |
| 12 | Ga0466713_123130 | 3300042602 | Bacteria | 16210 |
| 13 | Ga0466713_130028 | 3300042602 | Bacteria | 61506 |
| 14 | Ga0466716_190094 | 3300042605 | Bacteria | 7986 |
| 15 | Ga0466716_335142 | 3300042605 | Unclassified | 18209 |
| 16 | Ga0466719_233678 | 3300042606 | Bacteria | 6381 |
| 17 | Ga0466722_034720 | 3300042609 | Bacteria | 11820 |
| 18 | Ga0466698_011111 | 3300042610 | Bacteria | 1580 |
| 19 | Ga0223674_1001359 | 3300021235 | Unclassified | 1724 |
| 20 | Ga0466692_062004 | 3300042591 | Bacteria | 1620 |
| 21 | Ga0466691_122560 | 3300042593 | Bacteria | 7137 |
| 22 | Ga0466727_232273 | 3300042655 | Bacteria | 10216 |
| 23 | Ga0466705_199377 | 3300042612 | Unclassified | 5174 |
| 24 | Ga0466705_203071 | 3300042612 | Unclassified | 14274 |
| 25 | Ga0562379_0882 | 3300056790 | Unclassified | 44920 |
| 26 | Ga0123357_10074262 | 3300009784 | Bacteria | 4499 |
| 27 | Ga0123357_10081284 | 3300009784 | Unclassified | 4259 |
| 28 | Ga0466711_080726 | 3300042615 | Bacteria | 6587 |
| 29 | Ga0466711_163545 | 3300042615 | Bacteria | 5475 |
| 30 | Ga0466723_122161 | 3300042618 | Unclassified | 7474 |
| 31 | Ga0466723_171803 | 3300042618 | Bacteria | 59143 |
| 32 | Ga0466726_459986 | 3300042619 | Bacteria | 2259 |
| 33 | Ga0466728_016711 | 3300042620 | Unclassified | 29183 |
| 34 | Ga0466722_101098 | 3300042609 | Bacteria | 11490 |
| 35 | Ga0466690_015100 | 3300042590 | Bacteria | 9406 |
| 36 | Ga0466693_361691 | 3300042592 | Bacteria | 2578 |
| 37 | Ga0466703_132117 | 3300042636 | Unclassified | 2451 |
| 38 | Ga0466709_103879 | 3300042648 | Bacteria | 25802 |
| 39 | Ga0466733_090314 | 3300042659 | Bacteria | 23419 |
| 40 | Ga0530661_000056 | 3300056564 | Bacteria | 112781 |
| 41 | Ga0562379_0083 | 3300056790 | Bacteria | 343504 |
| 42 | IMNBL1DRAFT_c0000349 | 3300000062 | Bacteria | 39000 |
| 43 | HBC_ctgsDRAFT_1001707 | 3300000333 | Bacteria | 4833 |
| 44 | JGI24702J35022_10000197 | 3300002462 | Bacteria | 32672 |
| 45 | Ga0123357_10000620 | 3300009784 | Bacteria | 35228 |
| 46 | Ga0123355_10002977 | 3300009826 | Bacteria | 24075 |
| 47 | Ga0123355_10044320 | 3300009826 | Bacteria | 7241 |
| 48 | Ga0123356_10008041 | 3300010049 | Bacteria | 10497 |
| 49 | Ga0123353_10046059 | 3300010167 | Bacteria | 6926 |
| 50 | Ga0466715_399815 | 3300042616 | Bacteria | 13034 |
| 51 | Ga0466723_185528 | 3300042618 | Bacteria | 2477 |
| 52 | Ga0466729_106339 | 3300042621 | Bacteria | 41427 |
| 53 | Ga0466707_287775 | 3300042601 | Bacteria | 73891 |
| 54 | Ga0466713_031809 | 3300042602 | Unclassified | 7565 |
| 55 | Ga0466714_027164 | 3300042603 | Unclassified | 3423 |
| 56 | Ga0466714_100930 | 3300042603 | Unclassified | 3139 |
| 57 | Ga0466720_179168 | 3300042607 | Bacteria | 11542 |
| 58 | Ga0255809_1003342 | 3300022820 | Bacteria | 2006 |
| 59 | Ga0264413_102031 | 3300024493 | Bacteria | 23746 |
| 60 | Ga0264413_111172 | 3300024493 | Unclassified | 6199 |
| 61 | Ga0466692_178935 | 3300042591 | Bacteria | 17826 |
| 62 | Ga0466691_181989 | 3300042593 | Bacteria | 31345 |
| 63 | Ga0466735_046857 | 3300042624 | Bacteria | 6366 |
| 64 | Ga0466702_192353 | 3300042635 | Bacteria | 2253 |
| 65 | Ga0466703_247394 | 3300042636 | Bacteria | 6648 |
| 66 | Ga0466704_010101 | 3300042643 | Bacteria | 6986 |
| 67 | Ga0466704_579195 | 3300042643 | Bacteria | 3111 |
| 68 | Ga0466724_00717 | 3300042649 | Bacteria | 1962 |
| 69 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 70 | Ga0105553_1019925 | 3300007767 | Bacteria | 5528 |
| 71 | Ga0123356_10003912 | 3300010049 | Bacteria | 15506 |
| 72 | Ga0123356_10021227 | 3300010049 | Bacteria | 6133 |
| 73 | Ga0466715_584264 | 3300042616 | Bacteria | 12619 |
| 74 | Ga0466726_491709 | 3300042619 | Bacteria | 5531 |
| 75 | Ga0466714_020610 | 3300042603 | Bacteria | 12324 |
| 76 | Ga0466716_153284 | 3300042605 | Bacteria | 3702 |
| 77 | Ga0466716_364727 | 3300042605 | Bacteria | 2144 |
| 78 | Ga0466720_101410 | 3300042607 | Bacteria | 24290 |
| 79 | Ga0466691_151509 | 3300042593 | Bacteria | 42451 |
| 80 | Ga0466699_179323 | 3300042597 | Bacteria | 7742 |
| 81 | Ga0466704_149713 | 3300042643 | Bacteria | 1943 |
| 82 | Ga0466704_349181 | 3300042643 | Bacteria | 24462 |
| 83 | Ga0466705_015540 | 3300042612 | Bacteria | 18829 |
| 84 | Ga0466733_180186 | 3300042659 | Bacteria | 3737 |
| 85 | Ga0562379_0180 | 3300056790 | Bacteria | 182121 |
| 86 | Ga0562378_0234 | 3300056814 | Unclassified | 130023 |
| 87 | Ga0562377_0121 | 3300056842 | Bacteria | 244322 |
| 88 | Ga0562375_0100 | 3300056856 | Bacteria | 265693 |
| 89 | JGI24699J35502_11134017 | 3300002509 | Bacteria | 24388 |
| 90 | Ga0123356_10011537 | 3300010049 | Bacteria | 8608 |
| 91 | Ga0123354_10303682 | 3300010882 | Unclassified | 1504 |
| 92 | Ga0466723_076554 | 3300042618 | Bacteria | 3174 |
| 93 | Ga0466726_023497 | 3300042619 | Bacteria | 5621 |
| 94 | Ga0466728_060707 | 3300042620 | Bacteria | 27349 |
| 95 | Ga0466707_166627 | 3300042601 | Bacteria | 4486 |
| 96 | Ga0466713_130188 | 3300042602 | Bacteria | 9287 |
| 97 | Ga0466719_334198 | 3300042606 | Bacteria | 7146 |
| 98 | Ga0466719_555053 | 3300042606 | Bacteria | 24337 |
| 99 | Ga0466692_101751 | 3300042591 | Bacteria | 9153 |
| 100 | Ga0466703_136758 | 3300042636 | Bacteria | 2683 |
| 101 | Ga0466704_446954 | 3300042643 | Bacteria | 37901 |
| 102 | Ga0466708_071280 | 3300042652 | Unclassified | 6956 |
| 103 | Ga0466727_007283 | 3300042655 | Bacteria | 19246 |
| 104 | Ga0072941_1184461 | 3300005201 | Bacteria | 15468 |
| 105 | Ga0123357_10033701 | 3300009784 | Bacteria | 6962 |
| 106 | Ga0123356_10059720 | 3300010049 | Unclassified | 3557 |
| 107 | Ga0123356_10274498 | 3300010049 | Unclassified | 1777 |
| 108 | Ga0123353_10233159 | 3300010167 | Bacteria | 2867 |
| 109 | Ga0123353_10321404 | 3300010167 | Bacteria | 2348 |
| 110 | Ga0466711_099301 | 3300042615 | Bacteria | 13113 |
| 111 | Ga0466715_019839 | 3300042616 | Unclassified | 1659 |
| 112 | Ga0466718_067358 | 3300042617 | Bacteria | 2976 |
| 113 | Ga0466723_010964 | 3300042618 | Bacteria | 19788 |
| 114 | Ga0466729_192533 | 3300042621 | Bacteria | 4699 |
| 115 | Ga0466707_379533 | 3300042601 | Bacteria | 60700 |
| 116 | Ga0466713_040578 | 3300042602 | Bacteria | 2483 |
| 117 | Ga0466720_179727 | 3300042607 | Bacteria | 10615 |
| 118 | Ga0466722_011667 | 3300042609 | Bacteria | 11492 |
| 119 | Ga0466722_041519 | 3300042609 | Bacteria | 4299 |
| 120 | Ga0466722_184170 | 3300042609 | Bacteria | 4618 |
| 121 | Ga0466691_110726 | 3300042593 | Bacteria | 19058 |
| 122 | Ga0466703_017494 | 3300042636 | Bacteria | 9516 |
| 123 | Ga0466724_43483 | 3300042649 | Bacteria | 15072 |
| 124 | Ga0466727_266265 | 3300042655 | Bacteria | 8007 |
| 125 | Ga0466733_138033 | 3300042659 | Bacteria | 29090 |
| 126 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 127 | Ga0562376_0273 | 3300056857 | Bacteria | 102744 |
| 128 | JGI24698J34947_10012838 | 3300002449 | Bacteria | 4583 |
| 129 | JGI24699J35502_11100293 | 3300002509 | Unclassified | 2343 |
| 130 | Ga0123353_10219787 | 3300010167 | Bacteria | 2972 |
| 131 | Ga0123353_10322165 | 3300010167 | Bacteria | 2345 |
| 132 | Ga0123354_10055614 | 3300010882 | Bacteria | 5918 |
| 133 | Ga0466723_140042 | 3300042618 | Unclassified | 4198 |
| 134 | Ga0466723_156113 | 3300042618 | Bacteria | 8569 |
| 135 | Ga0466726_064508 | 3300042619 | Bacteria | 29319 |
| 136 | Ga0466726_099444 | 3300042619 | Bacteria | 2355 |
| 137 | Ga0466726_172257 | 3300042619 | Bacteria | 4698 |
| 138 | Ga0466706_065116 | 3300042599 | Bacteria | 4934 |
| 139 | Ga0466719_434722 | 3300042606 | Unclassified | 4114 |
| 140 | Ga0415639_079234 | 3300038395 | Unclassified | 5268 |
| 141 | Ga0466699_094542 | 3300042597 | Bacteria | 3398 |
| 142 | Ga0466699_115474 | 3300042597 | Bacteria | 10724 |
| 143 | Ga0466703_110935 | 3300042636 | Bacteria | 10315 |
| 144 | Ga0466704_199097 | 3300042643 | Bacteria | 4231 |
| 145 | Ga0466709_105063 | 3300042648 | Bacteria | 3866 |
| 146 | Ga0466708_212877 | 3300042652 | Bacteria | 79784 |
| 147 | Ga0562377_0264 | 3300056842 | Bacteria | 116515 |
| 148 | Ga0562377_2616 | 3300056842 | Unclassified | 12733 |
| 149 | CVPL010L_1000205 | 3300002932 | Bacteria | 21696 |
| 150 | Ga0068302_10199719 | 3300005071 | Unclassified | 2489 |
| 151 | Ga0123357_10083810 | 3300009784 | Bacteria | 4182 |
| 152 | Ga0123353_10073262 | 3300010167 | Bacteria | 5504 |
| 153 | Ga0466712_050234 | 3300042614 | Bacteria | 2434 |
| 154 | Ga0466723_356996 | 3300042618 | Bacteria | 27577 |
| 155 | Ga0466728_468774 | 3300042620 | Bacteria | 8273 |
| 156 | Ga0466701_061069 | 3300042598 | Bacteria | 27167 |
| 157 | Ga0466713_000418 | 3300042602 | Bacteria | 1724 |
| 158 | Ga0466713_030932 | 3300042602 | Bacteria | 92656 |
| 159 | Ga0466692_170530 | 3300042591 | Unclassified | 2390 |
| 160 | Ga0466696_269984 | 3300042596 | Bacteria | 11396 |
| 161 | Ga0466701_011083 | 3300042598 | Bacteria | 4776 |
| 162 | Ga0466735_010853 | 3300042624 | Bacteria | 17037 |
| 163 | Ga0466703_297824 | 3300042636 | Bacteria | 25464 |
| 164 | Ga0466709_005451 | 3300042648 | Bacteria | 19590 |
| 165 | Ga0466709_091746 | 3300042648 | Unclassified | 11306 |
| 166 | Ga0466709_151353 | 3300042648 | Unclassified | 8034 |
| 167 | Ga0466727_198980 | 3300042655 | Bacteria | 64809 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06751 | EutB | Ethanolamine ammonia lyase large subunit (EutB) | 15 | 447 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.