Protein Family IF09636
Metagenome
Isolate
265
Members
75
Samples
242
Scaffolds
181.21
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_237932|Ga0466709_237932_3182_3826
- Length
- 214 aa
- Sequence
- MEAISGKSQSVDERKYVPLLSVGRVEKYIIRRKMTHEIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSPVLNEYDIAIILNQPSMDKFELKVKKGGILIYDGYGIHKPAARNDIDVYRVNAMDAAAESNMSKTFNMIVLGGLLKVVPLVTLENVMKGLKKTLPERHYNLLPANEEAIRKGMDIIRKIS
Sample Types
Isolate
8.7%
Metagenome
91.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.1%
Blattidae
23.0%
Kalotermitidae
18.9%
Unclassified
9.5%
Rhinotermitidae
6.8%
Termopsidae
5.4%
Passalidae
4.1%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
249
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 2 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 3 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 9 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 10 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 29 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 38 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 45 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 48 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 49 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 50 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 53 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 54 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 62 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 63 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 64 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 65 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 66 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 67 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 68 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 69 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 70 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 71 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 72 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 73 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_068471 | 3300042612 | Bacteria | 9310 |
| 2 | Ga0466705_269867 | 3300042612 | Bacteria | 9669 |
| 3 | 2227485761 | 2225789004 | Bacteria | 21098 |
| 4 | JGI24696J40584_12719294 | 3300002834 | Bacteria | 757 |
| 5 | Ga0068302_10546777 | 3300005071 | Bacteria | 786 |
| 6 | Ga0466706_016347 | 3300042599 | Bacteria | 3942 |
| 7 | Ga0466706_123450 | 3300042599 | Bacteria | 8526 |
| 8 | Ga0466713_020992 | 3300042602 | Bacteria | 62959 |
| 9 | Ga0466713_041013 | 3300042602 | Bacteria | 31505 |
| 10 | Ga0466719_276033 | 3300042606 | Bacteria | 9562 |
| 11 | Ga0466720_085217 | 3300042607 | Bacteria | 1214 |
| 12 | Ga0466722_062607 | 3300042609 | Bacteria | 3730 |
| 13 | Ga0466722_204361 | 3300042609 | Bacteria | 3636 |
| 14 | Ga0466711_080977 | 3300042615 | Bacteria | 6892 |
| 15 | Ga0466718_117934 | 3300042617 | Bacteria | 2064 |
| 16 | Ga0466723_125525 | 3300042618 | Bacteria | 14542 |
| 17 | Ga0123354_10040335 | 3300010882 | Bacteria | 7224 |
| 18 | Ga0123354_10121208 | 3300010882 | Bacteria | 3376 |
| 19 | Ga0123354_10473864 | 3300010882 | Bacteria | 995 |
| 20 | Ga0466657_147471 | 3300042582 | Bacteria | 1034 |
| 21 | Ga0466690_079419 | 3300042590 | Bacteria | 8245 |
| 22 | Ga0466690_253817 | 3300042590 | Bacteria | 10765 |
| 23 | Ga0466691_047751 | 3300042593 | Bacteria | 1063 |
| 24 | Ga0466696_085036 | 3300042596 | Bacteria | 6487 |
| 25 | Ga0466735_008450 | 3300042624 | Bacteria | 1712 |
| 26 | Ga0466735_220463 | 3300042624 | Bacteria | 1180 |
| 27 | Ga0466703_251322 | 3300042636 | Unclassified | 3786 |
| 28 | Ga0466703_355752 | 3300042636 | Bacteria | 31206 |
| 29 | Ga0466704_067267 | 3300042643 | Bacteria | 9780 |
| 30 | Ga0466727_090010 | 3300042655 | Bacteria | 8453 |
| 31 | Ga0466727_106023 | 3300042655 | Bacteria | 80602 |
| 32 | Ga0466727_120961 | 3300042655 | Bacteria | 5719 |
| 33 | Ga0466733_190486 | 3300042659 | Bacteria | 10295 |
| 34 | IMNBL1DRAFT_c0001129 | 3300000062 | Bacteria | 20460 |
| 35 | IMNBL1DRAFT_c0032533 | 3300000062 | Bacteria | 1880 |
| 36 | Ga0068305_10009344 | 3300005083 | Bacteria | 20262 |
| 37 | Ga0072941_1284603 | 3300005201 | Bacteria | 3763 |
| 38 | Ga0123357_10001158 | 3300009784 | Bacteria | 27473 |
| 39 | Ga0466707_047433 | 3300042601 | Bacteria | 3983 |
| 40 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 41 | Ga0466716_084851 | 3300042605 | Bacteria | 10801 |
| 42 | Ga0466716_386801 | 3300042605 | Bacteria | 3580 |
| 43 | Ga0466722_037614 | 3300042609 | Bacteria | 16563 |
| 44 | Ga0466710_136644 | 3300042613 | Bacteria | 8901 |
| 45 | Ga0466723_012545 | 3300042618 | Bacteria | 9670 |
| 46 | Ga0466726_482313 | 3300042619 | Bacteria | 2604 |
| 47 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 48 | Ga0466729_062942 | 3300042621 | Bacteria | 1244 |
| 49 | Ga0123357_10267889 | 3300009784 | Bacteria | 1791 |
| 50 | Ga0123354_10000735 | 3300010882 | Bacteria | 35280 |
| 51 | Ga0466690_096620 | 3300042590 | Bacteria | 3835 |
| 52 | Ga0466693_002831 | 3300042592 | Unclassified | 1423 |
| 53 | Ga0466691_031003 | 3300042593 | Bacteria | 14168 |
| 54 | Ga0466695_259771 | 3300042595 | Unclassified | 2152 |
| 55 | Ga0466696_140347 | 3300042596 | Unclassified | 4710 |
| 56 | Ga0466735_232746 | 3300042624 | Unclassified | 2654 |
| 57 | Ga0466704_350333 | 3300042643 | Bacteria | 20772 |
| 58 | Ga0466704_472879 | 3300042643 | Bacteria | 13574 |
| 59 | Ga0466708_108693 | 3300042652 | Bacteria | 11910 |
| 60 | Ga0466727_076192 | 3300042655 | Bacteria | 4594 |
| 61 | Ga0466705_023779 | 3300042612 | Bacteria | 12423 |
| 62 | Ga0466733_029904 | 3300042659 | Bacteria | 2239 |
| 63 | Ga0466733_149641 | 3300042659 | Bacteria | 18486 |
| 64 | Ga0123357_10000769 | 3300009784 | Bacteria | 32386 |
| 65 | Ga0466707_414711 | 3300042601 | Bacteria | 12149 |
| 66 | Ga0466714_101320 | 3300042603 | Bacteria | 1760 |
| 67 | Ga0466716_068984 | 3300042605 | Bacteria | 6876 |
| 68 | Ga0466719_206576 | 3300042606 | Bacteria | 9122 |
| 69 | Ga0466722_246313 | 3300042609 | Bacteria | 1143 |
| 70 | Ga0466715_138418 | 3300042616 | Bacteria | 28149 |
| 71 | Ga0466723_101754 | 3300042618 | Bacteria | 10500 |
| 72 | Ga0123357_10167007 | 3300009784 | Bacteria | 2617 |
| 73 | Ga0123356_11638350 | 3300010049 | Bacteria | 797 |
| 74 | Ga0123353_11182000 | 3300010167 | Bacteria | 1006 |
| 75 | Ga0123354_10029065 | 3300010882 | Bacteria | 8701 |
| 76 | Ga0123354_10046665 | 3300010882 | Unclassified | 6615 |
| 77 | Ga0466656_061497 | 3300042550 | Bacteria | 8002 |
| 78 | Ga0466694_156591 | 3300042594 | Bacteria | 1608 |
| 79 | Ga0466696_248480 | 3300042596 | Bacteria | 8299 |
| 80 | Ga0466696_467554 | 3300042596 | Bacteria | 10777 |
| 81 | Ga0466704_044961 | 3300042643 | Bacteria | 2873 |
| 82 | Ga0466704_408836 | 3300042643 | Bacteria | 6831 |
| 83 | Ga0466709_370540 | 3300042648 | Bacteria | 10300 |
| 84 | Ga0466727_082740 | 3300042655 | Bacteria | 1353 |
| 85 | 2227218304 | 2225789004 | Unclassified | 1395 |
| 86 | 2227567707 | 2225789004 | Bacteria | 2649 |
| 87 | 2227657407 | 2225789004 | Bacteria | 1965 |
| 88 | JGI24702J35022_10014422 | 3300002462 | Bacteria | 4360 |
| 89 | JGI24702J35022_10301509 | 3300002462 | Unclassified | 946 |
| 90 | JGI24696J40584_12815400 | 3300002834 | Unclassified | 896 |
| 91 | Ga0466706_282805 | 3300042599 | Unclassified | 2016 |
| 92 | Ga0466700_018134 | 3300042600 | Bacteria | 5994 |
| 93 | Ga0466700_392445 | 3300042600 | Bacteria | 26880 |
| 94 | Ga0466713_037701 | 3300042602 | Bacteria | 30244 |
| 95 | Ga0466716_281959 | 3300042605 | Bacteria | 2721 |
| 96 | Ga0466722_108746 | 3300042609 | Bacteria | 15437 |
| 97 | Ga0466711_042337 | 3300042615 | Bacteria | 11612 |
| 98 | Ga0466715_011076 | 3300042616 | Bacteria | 39815 |
| 99 | Ga0466726_425750 | 3300042619 | Bacteria | 5812 |
| 100 | Ga0466657_148578 | 3300042582 | Bacteria | 1533 |
| 101 | Ga0466692_166187 | 3300042591 | Bacteria | 20656 |
| 102 | Ga0466691_199211 | 3300042593 | Bacteria | 19849 |
| 103 | Ga0466729_217293 | 3300042621 | Bacteria | 5729 |
| 104 | Ga0466735_152364 | 3300042624 | Bacteria | 4491 |
| 105 | Ga0466703_212954 | 3300042636 | Bacteria | 10233 |
| 106 | Ga0466704_176646 | 3300042643 | Bacteria | 62821 |
| 107 | Ga0466709_060912 | 3300042648 | Bacteria | 22527 |
| 108 | Ga0466709_186617 | 3300042648 | Bacteria | 9879 |
| 109 | Ga0466708_011017 | 3300042652 | Bacteria | 14569 |
| 110 | Ga0466708_023581 | 3300042652 | Bacteria | 13912 |
| 111 | Ga0466725_012412 | 3300042654 | Bacteria | 26917 |
| 112 | Ga0466727_101934 | 3300042655 | Bacteria | 1573 |
| 113 | IMNBL1DRAFT_c0000274 | 3300000062 | Bacteria | 45532 |
| 114 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 115 | JGI24702J35022_10251377 | 3300002462 | Bacteria | 1028 |
| 116 | JGI24699J35502_11133334 | 3300002509 | Bacteria | 9904 |
| 117 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 118 | JGI24696J40584_12830297 | 3300002834 | Bacteria | 929 |
| 119 | Ga0068302_10203005 | 3300005071 | Bacteria | 4127 |
| 120 | Ga0068305_10003475 | 3300005083 | Bacteria | 10580 |
| 121 | Ga0466707_024783 | 3300042601 | Bacteria | 27160 |
| 122 | Ga0466707_115297 | 3300042601 | Bacteria | 11659 |
| 123 | Ga0466707_377742 | 3300042601 | Bacteria | 6594 |
| 124 | Ga0466713_078329 | 3300042602 | Bacteria | 27454 |
| 125 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 126 | Ga0466716_124614 | 3300042605 | Bacteria | 21979 |
| 127 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 128 | Ga0466711_286714 | 3300042615 | Bacteria | 23462 |
| 129 | Ga0466715_255387 | 3300042616 | Bacteria | 2893 |
| 130 | Ga0466715_429111 | 3300042616 | Bacteria | 6362 |
| 131 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 132 | Ga0466723_182664 | 3300042618 | Bacteria | 13551 |
| 133 | Ga0466726_391086 | 3300042619 | Bacteria | 1010 |
| 134 | Ga0466728_181334 | 3300042620 | Bacteria | 75129 |
| 135 | Ga0123357_10004404 | 3300009784 | Bacteria | 16524 |
| 136 | Ga0123357_10008216 | 3300009784 | Bacteria | 13008 |
| 137 | Ga0123356_10173727 | 3300010049 | Bacteria | 2168 |
| 138 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 139 | Ga0466692_114059 | 3300042591 | Bacteria | 7730 |
| 140 | Ga0466691_029267 | 3300042593 | Bacteria | 26342 |
| 141 | Ga0466701_000546 | 3300042598 | Bacteria | 7787 |
| 142 | Ga0466735_099507 | 3300042624 | Bacteria | 5665 |
| 143 | Ga0466735_183905 | 3300042624 | Bacteria | 1304 |
| 144 | Ga0466730_036149 | 3300042625 | Bacteria | 7760 |
| 145 | Ga0466703_048877 | 3300042636 | Bacteria | 2674 |
| 146 | Ga0466703_226005 | 3300042636 | Unclassified | 3568 |
| 147 | Ga0466709_237932 | 3300042648 | Bacteria | 7852 |
| 148 | Ga0466708_117511 | 3300042652 | Bacteria | 28515 |
| 149 | Ga0466697_086743 | 3300042611 | Bacteria | 3603 |
| 150 | Ga0466733_006222 | 3300042659 | Bacteria | 41230 |
| 151 | Ga0466733_025416 | 3300042659 | Bacteria | 189255 |
| 152 | Ga0466733_134752 | 3300042659 | Bacteria | 3413 |
| 153 | Ga0466733_176526 | 3300042659 | Bacteria | 102706 |
| 154 | 2227017619 | 2225789003 | Bacteria | 1057 |
| 155 | 2227288020 | 2225789004 | Bacteria | 1246 |
| 156 | 2227474399 | 2225789004 | Bacteria | 898 |
| 157 | IMNBL1DRAFT_c0000345 | 3300000062 | Bacteria | 39398 |
| 158 | IMNBL1DRAFT_c0023384 | 3300000062 | Bacteria | 2421 |
| 159 | Ga0068305_10020657 | 3300005083 | Bacteria | 24279 |
| 160 | Ga0466701_038657 | 3300042598 | Bacteria | 3594 |
| 161 | Ga0466706_025945 | 3300042599 | Bacteria | 100859 |
| 162 | Ga0466706_034623 | 3300042599 | Bacteria | 20734 |
| 163 | Ga0466700_020224 | 3300042600 | Bacteria | 23800 |
| 164 | Ga0466713_109573 | 3300042602 | Bacteria | 6566 |
| 165 | Ga0466716_327829 | 3300042605 | Bacteria | 7964 |
| 166 | Ga0466722_127247 | 3300042609 | Bacteria | 26149 |
| 167 | Ga0466715_042803 | 3300042616 | Unclassified | 2898 |
| 168 | Ga0466715_445638 | 3300042616 | Bacteria | 5402 |
| 169 | Ga0466726_096510 | 3300042619 | Bacteria | 17649 |
| 170 | Ga0466729_058024 | 3300042621 | Bacteria | 17363 |
| 171 | Ga0466657_086347 | 3300042582 | Bacteria | 2699 |
| 172 | Ga0466690_264520 | 3300042590 | Bacteria | 31137 |
| 173 | Ga0466692_176208 | 3300042591 | Bacteria | 6802 |
| 174 | Ga0466693_160343 | 3300042592 | Bacteria | 1547 |
| 175 | Ga0466696_123492 | 3300042596 | Bacteria | 14968 |
| 176 | Ga0466696_224496 | 3300042596 | Bacteria | 7456 |
| 177 | Ga0466696_227170 | 3300042596 | Bacteria | 9389 |
| 178 | Ga0466735_026945 | 3300042624 | Bacteria | 1457 |
| 179 | Ga0466735_061997 | 3300042624 | Bacteria | 1036 |
| 180 | Ga0466735_149582 | 3300042624 | Unclassified | 1165 |
| 181 | Ga0466735_186778 | 3300042624 | Unclassified | 2641 |
| 182 | Ga0466703_066112 | 3300042636 | Bacteria | 22062 |
| 183 | Ga0466703_164206 | 3300042636 | Bacteria | 7385 |
| 184 | Ga0466704_016776 | 3300042643 | Bacteria | 3845 |
| 185 | JGI24702J35022_10001135 | 3300002462 | Bacteria | 16563 |
| 186 | Ga0068305_10073818 | 3300005083 | Bacteria | 7042 |
| 187 | Ga0123357_10000694 | 3300009784 | Bacteria | 33749 |
| 188 | Ga0466701_096398 | 3300042598 | Bacteria | 39327 |
| 189 | Ga0466706_236505 | 3300042599 | Bacteria | 51327 |
| 190 | Ga0466706_273696 | 3300042599 | Bacteria | 9362 |
| 191 | Ga0466707_260122 | 3300042601 | Bacteria | 5581 |
| 192 | Ga0466713_105305 | 3300042602 | Bacteria | 2508 |
| 193 | Ga0466719_433192 | 3300042606 | Bacteria | 5396 |
| 194 | Ga0466711_123903 | 3300042615 | Bacteria | 10875 |
| 195 | Ga0466715_184077 | 3300042616 | Bacteria | 7041 |
| 196 | Ga0466723_229683 | 3300042618 | Bacteria | 7289 |
| 197 | Ga0466726_141457 | 3300042619 | Bacteria | 39794 |
| 198 | Ga0466726_319718 | 3300042619 | Bacteria | 14297 |
| 199 | Ga0466728_011534 | 3300042620 | Bacteria | 28821 |
| 200 | Ga0466728_159995 | 3300042620 | Bacteria | 20105 |
| 201 | Ga0466728_272533 | 3300042620 | Bacteria | 27391 |
| 202 | Ga0123357_10106677 | 3300009784 | Bacteria | 3590 |
| 203 | Ga0123356_12198441 | 3300010049 | Unclassified | 689 |
| 204 | Ga0123354_10489010 | 3300010882 | Bacteria | 967 |
| 205 | Ga0466696_141833 | 3300042596 | Bacteria | 18307 |
| 206 | Ga0466696_168764 | 3300042596 | Bacteria | 12119 |
| 207 | Ga0466696_461882 | 3300042596 | Bacteria | 1737 |
| 208 | Ga0466729_304089 | 3300042621 | Bacteria | 3988 |
| 209 | Ga0466729_309431 | 3300042621 | Bacteria | 11898 |
| 210 | Ga0466735_151811 | 3300042624 | Bacteria | 2733 |
| 211 | Ga0466733_213623 | 3300042659 | Bacteria | 3511 |
| 212 | 2227362496 | 2225789004 | Unclassified | 1126 |
| 213 | IMNBL1DRAFT_c0000269 | 3300000062 | Bacteria | 45968 |
| 214 | Ga0068305_10656162 | 3300005083 | Bacteria | 1483 |
| 215 | Ga0072941_1242413 | 3300005201 | Bacteria | 5600 |
| 216 | Ga0466706_107662 | 3300042599 | Bacteria | 1132 |
| 217 | Ga0466707_151862 | 3300042601 | Bacteria | 14895 |
| 218 | Ga0466713_084601 | 3300042602 | Bacteria | 2112 |
| 219 | Ga0466713_140350 | 3300042602 | Bacteria | 7565 |
| 220 | Ga0466716_546398 | 3300042605 | Bacteria | 1577 |
| 221 | Ga0466719_364311 | 3300042606 | Bacteria | 8124 |
| 222 | Ga0466719_464600 | 3300042606 | Bacteria | 2527 |
| 223 | Ga0466722_158029 | 3300042609 | Bacteria | 1322 |
| 224 | Ga0466697_000883 | 3300042611 | Bacteria | 2737 |
| 225 | Ga0466712_307511 | 3300042614 | Bacteria | 4540 |
| 226 | Ga0466715_094232 | 3300042616 | Bacteria | 10163 |
| 227 | Ga0466715_384196 | 3300042616 | Bacteria | 8401 |
| 228 | Ga0466729_015062 | 3300042621 | Bacteria | 2199 |
| 229 | Ga0123357_10008089 | 3300009784 | Bacteria | 13100 |
| 230 | Ga0123356_10011293 | 3300010049 | Bacteria | 8715 |
| 231 | Ga0123356_10643358 | 3300010049 | Bacteria | 1227 |
| 232 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 233 | Ga0123354_10112501 | 3300010882 | Bacteria | 3583 |
| 234 | Ga0123354_10122520 | 3300010882 | Bacteria | 3346 |
| 235 | Ga0123354_10198916 | 3300010882 | Bacteria | 2212 |
| 236 | Ga0466656_291703 | 3300042550 | Bacteria | 1217 |
| 237 | Ga0466690_258904 | 3300042590 | Bacteria | 4664 |
| 238 | Ga0466692_121070 | 3300042591 | Bacteria | 8911 |
| 239 | Ga0466693_185417 | 3300042592 | Bacteria | 1339 |
| 240 | Ga0466703_077922 | 3300042636 | Bacteria | 14196 |
| 241 | Ga0466704_281081 | 3300042643 | Bacteria | 1702 |
| 242 | Ga0466709_222588 | 3300042648 | Bacteria | 4088 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 44 | 208 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.