Protein Family IF09631
Metagenome
Isolate
143
Members
61
Samples
125
Scaffolds
456.65
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_225532|Ga0466709_225532_133_1725
- Length
- 530 aa
- Sequence
- LGKQPWIYGKKWASDHFFKSLPQNQPGFGKGSNLSLLREPVLESAHCPEWTGRGLTNGLYTIFEEAAMSGFGLIVIFVVAXXXMILAISKFKIHPFLSIMTVSLLFGLAAGIPLVNVQDANGNTIQGIANVIGAGFSGTFTSIGIVIILGALIGTILEATGAAFKLADMVIGLVGSKRPVLAVQLMGWVVSIPVFCDSGFVILDPIRKALVKRTRISSVAMTVALSTGLYASHVFIPPTPGPIAAANTLGVGNNLLLVMGLGLLVSIPALIGAILYSQYIGGKVKSSEDVDIDGAAQSYEELVAAYGNLPNGGASLAPIVVPIILMALGSIASMAKWTGFLFQICSFLGTPIIALAVGVLFAIWQLGIVKKLDRFYEITNETLKVVGPILFITAAGGVLGRVISSTGIVGFITGNSQTLAVVGIFFPFILSAILKTAQGSSTVALTTTAGIVAPLLGVLGLDSPARTALTVMAIGAGAMTVSHANDSYFWVVTNFGGMTPEQGYKAQTTATLIEGVCGMLGVFILSLILR
Sample Types
Isolate
12.6%
Metagenome
87.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.7%
Kalotermitidae
23.3%
Unclassified
20.0%
Blattidae
13.3%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Hydrophilidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
1
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 2 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 3 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 10 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 21 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 22 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 23 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 36 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 37 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 38 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 39 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 40 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 46 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 55 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 56 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_015168 | 3300042659 | Bacteria | 13554 |
| 2 | Ga0466733_141420 | 3300042659 | Bacteria | 62681 |
| 3 | Ga0466733_154511 | 3300042659 | Bacteria | 3886 |
| 4 | Ga0456237_0001933 | 3300041968 | Unclassified | 3341 |
| 5 | Ga0466692_063315 | 3300042591 | Bacteria | 15050 |
| 6 | Ga0466692_076992 | 3300042591 | Bacteria | 4240 |
| 7 | Ga0466694_047676 | 3300042594 | Bacteria | 5048 |
| 8 | Ga0466694_123398 | 3300042594 | Unclassified | 1803 |
| 9 | Ga0466696_019579 | 3300042596 | Bacteria | 8754 |
| 10 | Ga0466696_048261 | 3300042596 | Bacteria | 9468 |
| 11 | Ga0466715_412069 | 3300042616 | Bacteria | 4055 |
| 12 | Ga0466723_008797 | 3300042618 | Bacteria | 19524 |
| 13 | Ga0466723_369926 | 3300042618 | Bacteria | 30160 |
| 14 | Ga0466726_273349 | 3300042619 | Bacteria | 2488 |
| 15 | Ga0466704_095658 | 3300042643 | Bacteria | 3276 |
| 16 | Ga0466709_031618 | 3300042648 | Bacteria | 71844 |
| 17 | Ga0466709_069678 | 3300042648 | Bacteria | 2886 |
| 18 | Ga0466708_007965 | 3300042652 | Unclassified | 17055 |
| 19 | Ga0123355_10023690 | 3300009826 | Bacteria | 9860 |
| 20 | Ga0466706_199978 | 3300042599 | Bacteria | 2396 |
| 21 | Ga0466707_092299 | 3300042601 | Bacteria | 1396 |
| 22 | Ga0466719_171723 | 3300042606 | Bacteria | 3322 |
| 23 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 24 | JGI24703J35330_11708089 | 3300002501 | Bacteria | 2131 |
| 25 | Ga0466694_243323 | 3300042594 | Bacteria | 1868 |
| 26 | Ga0466711_163734 | 3300042615 | Bacteria | 2358 |
| 27 | Ga0466726_216157 | 3300042619 | Bacteria | 10995 |
| 28 | Ga0466704_141132 | 3300042643 | Bacteria | 3095 |
| 29 | Ga0466704_450827 | 3300042643 | Bacteria | 26422 |
| 30 | Ga0466713_080689 | 3300042602 | Bacteria | 11218 |
| 31 | Ga0466719_050629 | 3300042606 | Bacteria | 9134 |
| 32 | Ga0466722_057695 | 3300042609 | Bacteria | 9999 |
| 33 | Ga0466722_104667 | 3300042609 | Bacteria | 2110 |
| 34 | Ga0466690_032228 | 3300042590 | Bacteria | 13667 |
| 35 | Ga0466711_373940 | 3300042615 | Bacteria | 5023 |
| 36 | Ga0466723_260754 | 3300042618 | Bacteria | 6782 |
| 37 | Ga0466726_283490 | 3300042619 | Bacteria | 10151 |
| 38 | Ga0466703_028211 | 3300042636 | Bacteria | 3641 |
| 39 | Ga0466704_262789 | 3300042643 | Bacteria | 5583 |
| 40 | Ga0466709_225532 | 3300042648 | Bacteria | 10117 |
| 41 | Ga0466708_058677 | 3300042652 | Bacteria | 2458 |
| 42 | Ga0466727_253446 | 3300042655 | Bacteria | 1872 |
| 43 | Ga0466707_136196 | 3300042601 | Bacteria | 2710 |
| 44 | Ga0466717_308619 | 3300042604 | Bacteria | 2227 |
| 45 | Ga0466722_009039 | 3300042609 | Bacteria | 23176 |
| 46 | Ga0466722_015359 | 3300042609 | Bacteria | 1917 |
| 47 | Ga0466722_085913 | 3300042609 | Bacteria | 8129 |
| 48 | Ga0466722_089384 | 3300042609 | Bacteria | 5620 |
| 49 | Ga0466722_146426 | 3300042609 | Bacteria | 5607 |
| 50 | Ga0466733_152247 | 3300042659 | Bacteria | 20641 |
| 51 | Ga0072941_1120022 | 3300005201 | Bacteria | 2377 |
| 52 | Ga0466692_145016 | 3300042591 | Bacteria | 3052 |
| 53 | Ga0466691_102873 | 3300042593 | Bacteria | 8272 |
| 54 | Ga0466711_179438 | 3300042615 | Bacteria | 50784 |
| 55 | Ga0466715_008828 | 3300042616 | Bacteria | 3024 |
| 56 | Ga0466703_329846 | 3300042636 | Bacteria | 2831 |
| 57 | Ga0466708_106984 | 3300042652 | Bacteria | 4295 |
| 58 | Ga0466727_223262 | 3300042655 | Bacteria | 3633 |
| 59 | Ga0123355_10146070 | 3300009826 | Bacteria | 3606 |
| 60 | Ga0123355_10240920 | 3300009826 | Bacteria | 2562 |
| 61 | Ga0466719_058803 | 3300042606 | Bacteria | 3559 |
| 62 | Ga0466722_060748 | 3300042609 | Bacteria | 11446 |
| 63 | Ga0466722_211466 | 3300042609 | Bacteria | 2834 |
| 64 | Ga0466705_191044 | 3300042612 | Bacteria | 15103 |
| 65 | Ga0466705_209666 | 3300042612 | Bacteria | 9264 |
| 66 | Ga0466705_333017 | 3300042612 | Bacteria | 12845 |
| 67 | JGI24700J35501_10930930 | 3300002508 | Bacteria | 59746 |
| 68 | Ga0456237_0000829 | 3300041968 | Bacteria | 4826 |
| 69 | Ga0466690_396812 | 3300042590 | Bacteria | 2967 |
| 70 | Ga0466691_068880 | 3300042593 | Unclassified | 8289 |
| 71 | Ga0466703_275984 | 3300042636 | Bacteria | 7773 |
| 72 | Ga0466727_035711 | 3300042655 | Bacteria | 1435 |
| 73 | Ga0466706_209423 | 3300042599 | Unclassified | 4654 |
| 74 | Ga0466705_345525 | 3300042612 | Unclassified | 2796 |
| 75 | Ga0466733_142783 | 3300042659 | Bacteria | 38757 |
| 76 | Ga0072940_1020428 | 3300005200 | Bacteria | 2977 |
| 77 | Ga0466693_017503 | 3300042592 | Bacteria | 2799 |
| 78 | Ga0466691_061359 | 3300042593 | Bacteria | 17816 |
| 79 | Ga0466694_074077 | 3300042594 | Unclassified | 7002 |
| 80 | Ga0466715_402198 | 3300042616 | Bacteria | 75218 |
| 81 | Ga0466726_355464 | 3300042619 | Bacteria | 2746 |
| 82 | Ga0466728_226799 | 3300042620 | Bacteria | 3811 |
| 83 | Ga0466731_074574 | 3300042622 | Bacteria | 1926 |
| 84 | Ga0466704_018503 | 3300042643 | Bacteria | 8736 |
| 85 | Ga0466709_288428 | 3300042648 | Bacteria | 21089 |
| 86 | Ga0466713_147569 | 3300042602 | Bacteria | 7150 |
| 87 | Ga0466716_087721 | 3300042605 | Bacteria | 5821 |
| 88 | Ga0466705_039613 | 3300042612 | Unclassified | 1866 |
| 89 | Ga0466733_054106 | 3300042659 | Bacteria | 6774 |
| 90 | Ga0068302_10070370 | 3300005071 | Bacteria | 5995 |
| 91 | Ga0068305_10001514 | 3300005083 | Unclassified | 23110 |
| 92 | Ga0466694_341952 | 3300042594 | Bacteria | 2005 |
| 93 | Ga0466695_031110 | 3300042595 | Bacteria | 4093 |
| 94 | Ga0466723_131133 | 3300042618 | Bacteria | 4208 |
| 95 | Ga0466723_163964 | 3300042618 | Bacteria | 6174 |
| 96 | Ga0466731_014019 | 3300042622 | Bacteria | 1888 |
| 97 | Ga0466725_349595 | 3300042654 | Bacteria | 2655 |
| 98 | Ga0123356_10116683 | 3300010049 | Bacteria | 2589 |
| 99 | Ga0123354_10011353 | 3300010882 | Bacteria | 13754 |
| 100 | Ga0466716_023995 | 3300042605 | Archaea | 3027 |
| 101 | Ga0466716_170006 | 3300042605 | Bacteria | 3231 |
| 102 | Ga0466719_575547 | 3300042606 | Bacteria | 2344 |
| 103 | Ga0466720_021285 | 3300042607 | Bacteria | 2652 |
| 104 | Ga0466721_240722 | 3300042608 | Bacteria | 1667 |
| 105 | Ga0466733_115207 | 3300042659 | Bacteria | 2169 |
| 106 | JGI24695J34938_10050851 | 3300002450 | Bacteria | 1816 |
| 107 | JGI24703J35330_11748746 | 3300002501 | Bacteria | 30877 |
| 108 | Ga0456237_0000863 | 3300041968 | Bacteria | 4759 |
| 109 | Ga0466691_145700 | 3300042593 | Bacteria | 11052 |
| 110 | Ga0466694_192875 | 3300042594 | Bacteria | 48557 |
| 111 | Ga0466694_406213 | 3300042594 | Bacteria | 27257 |
| 112 | Ga0466696_414362 | 3300042596 | Bacteria | 3221 |
| 113 | Ga0466715_096853 | 3300042616 | Bacteria | 12428 |
| 114 | Ga0466726_103746 | 3300042619 | Bacteria | 1848 |
| 115 | Ga0466726_220388 | 3300042619 | Bacteria | 1743 |
| 116 | Ga0466729_171252 | 3300042621 | Bacteria | 3519 |
| 117 | Ga0466735_158629 | 3300042624 | Bacteria | 2599 |
| 118 | Ga0466703_070661 | 3300042636 | Bacteria | 3976 |
| 119 | Ga0466703_121667 | 3300042636 | Bacteria | 1557 |
| 120 | Ga0466703_200368 | 3300042636 | Bacteria | 32386 |
| 121 | Ga0466703_204570 | 3300042636 | Bacteria | 1799 |
| 122 | Ga0466708_386397 | 3300042652 | Unclassified | 3929 |
| 123 | Ga0466707_287858 | 3300042601 | Unclassified | 2417 |
| 124 | Ga0466716_203278 | 3300042605 | Bacteria | 16353 |
| 125 | Ga0466722_008966 | 3300042609 | Bacteria | 3987 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.